SecReT6
Protein ID: 507480527
SecReT6 ID792
T6SS typei4b
Gene symboltssE
Locus tagtssE
StrainAcinetobacter baumannii M2
Repliconchromosome [GenBank: KC432605] [Browse all T6SS(s) in this replicon]
Location [Strand]5295..5771 [+]
Producthypothetical protein
NoteTssE
UniProt IDR9RHI3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-18, Aligned region: 32..135
Protein Sequence: 158 a.a.     [Download]
>gi|507480527|ref|AGM48621.1| hypothetical protein [Acinetobacter baumannii]
MNLDRLYPYGFRSTLFDRLIPESEDYAKGLSIQQLRESVAKDLEDLLNSRVAKLDHVVDDYPLVKKSILQ
FGIIDFVGLSTANPLDRDKICQSIEQSIAAHEPRLRQIRVEMLLDGHNMGALCLSIQAYLNIHPLYEPVV
FDALLKPTTQQYVISART
 
Nucleotide Sequence: 477 bp     [Download]
>gi|507480521|gb|KC432605|tssE|:5295-5771
ATGAACTTAGATCGGCTTTATCCATACGGATTTCGTTCAACTTTATTTGATCGCTTAATTCCAGAAAGTG
AAGATTATGCAAAAGGTCTTTCTATTCAGCAATTAAGAGAATCTGTAGCAAAGGATTTAGAAGATTTGCT
CAATAGTCGGGTAGCAAAGTTAGATCATGTAGTTGATGACTATCCACTTGTAAAGAAATCGATACTTCAG
TTTGGGATTATTGATTTTGTAGGGCTCTCTACAGCCAACCCTTTAGACCGAGATAAAATTTGCCAATCCA
TTGAGCAATCCATAGCAGCTCATGAGCCTCGGCTAAGACAAATACGGGTAGAGATGTTGTTAGATGGACA
TAATATGGGCGCATTATGTTTAAGTATTCAGGCTTATCTAAATATTCACCCTCTATATGAACCTGTTGTA
TTTGATGCATTGTTAAAACCAACAACGCAGCAGTATGTAATTTCAGCGAGAACTTAA