SecReT6
Protein ID: 507480528
SecReT6 ID792
T6SS typei4b
Gene symboltssF
Locus tagtssF
StrainAcinetobacter baumannii M2
Repliconchromosome [GenBank: KC432605] [Browse all T6SS(s) in this replicon]
Location [Strand]5788..7599 [+]
ProductImpG
NoteTssF
UniProt IDR9RHJ4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.90E-156, Aligned region: 5..603
Protein Sequence: 603 a.a.     [Download]
>gi|507480528|ref|AGM48622.1| ImpG [Acinetobacter baumannii]
MIEELLPFYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARIDKKLTDSYDV
FTRSLFEVMFPQYLRHFPACSVVSFEDINKIKQLTEPHLVPDHTVLKSRSFKGVQCEFNTTQDVKLLPIH
LSGLDFKTTPSAHMHLNQNATLSLKFEIFNSAHACLIHEKLPIYLDAISNFPLQVLDSIFKKGTSFAVKH
GQTIVELGKNPFELIGFSEQESLLPLDQHTHHAYRLLMEYFCFPEKFSYLKLDLDFLKGLPQQVSEFELL
IHFKLNLNDQAVVRNYSELNIANFKLFTTPVINLFEKYAEPQKIVHKQLEYPLVTDAHHPEFYQVYSILE
MNMVREKTNQEESYVPVLPFFAMSHYHNDTARFFYSVNYQKLQSNFVEMGYSIISKNLNPFSTRSDFIST
KLLCSNRDLPHEALGQSNNVLNLNDSSLARRAIVLKRPTKPYKFEQGQSEQWRVISHLSLNSLALMKGDA
VSHVKELLALYNLPQSKENYLIIESIKKLEFSLTHKLVDGKPFPMFVRGVKAELQIDSSVFRGHSLYIFS
QLLSRVFNLKVQINSFVDLVVKDYSSQQELYQCSQNVGGKTLL
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|507480521|gb|KC432605|tssF|:5788-7599
GTGATAGAAGAGCTTTTACCGTTTTATGAAAAACAATTACAAGAATTTGGTCAGCAATCTCGAGAATTTG
CCCAAAAATATCCAAAAATTGCTCAGCGCTTATCTTTAAATCAAGAGCAAATTGATGACCCGCATATTGA
ACGTCTGATACAGGCTTTTTCGCTGATTGCCGCTCGAATCGATAAAAAACTTACAGACAGTTATGATGTT
TTTACTCGTTCTTTATTTGAGGTGATGTTTCCTCAATACTTGCGTCATTTTCCTGCTTGTTCAGTTGTTA
GCTTTGAAGATATTAATAAAATCAAACAGCTTACAGAGCCTCATCTTGTACCTGACCATACGGTTTTGAA
GTCTCGTAGTTTCAAGGGAGTACAGTGTGAGTTTAATACAACTCAAGATGTTAAATTACTACCTATTCAT
TTAAGTGGTTTAGATTTTAAAACTACACCTAGTGCACATATGCACTTAAACCAAAATGCGACGTTGAGCC
TTAAATTTGAAATTTTCAATAGTGCTCATGCATGCTTAATTCATGAGAAGCTTCCTATTTATTTGGATGC
TATCTCCAATTTTCCTTTACAAGTACTTGATAGTATTTTCAAAAAAGGGACCAGTTTTGCGGTTAAACAT
GGTCAAACGATTGTCGAGTTGGGTAAGAATCCATTCGAGTTAATAGGTTTTTCTGAACAAGAAAGTTTAT
TACCCCTCGATCAACATACGCATCATGCTTATCGTTTATTAATGGAGTATTTTTGTTTCCCAGAAAAGTT
TAGCTACCTGAAACTTGATTTAGATTTTTTAAAAGGGTTACCTCAGCAAGTATCTGAATTTGAGCTTTTA
ATTCATTTTAAATTAAATTTAAACGATCAAGCCGTTGTTAGAAACTATTCTGAATTAAATATTGCAAACT
TTAAATTGTTTACTACCCCAGTAATCAACCTGTTTGAAAAATATGCGGAACCTCAAAAAATAGTTCATAA
GCAACTCGAATATCCACTCGTTACAGACGCTCACCATCCTGAATTTTATCAAGTATATTCAATACTTGAG
ATGAATATGGTGCGTGAAAAAACAAATCAGGAAGAAAGCTATGTTCCTGTTTTACCATTTTTTGCGATGA
GCCATTATCACAATGATACAGCTCGCTTTTTTTATTCAGTGAATTATCAAAAGTTACAGTCTAATTTTGT
TGAAATGGGCTATTCCATTATTTCTAAAAATCTAAATCCATTTTCAACACGTTCAGATTTTATTAGCACC
AAATTATTATGTTCAAACCGTGACTTGCCTCATGAAGCACTGGGACAGTCTAATAACGTATTAAATTTAA
ATGATAGTAGCTTGGCTAGACGTGCCATTGTTTTAAAACGGCCAACAAAGCCTTATAAGTTTGAACAAGG
CCAAAGTGAGCAATGGCGTGTGATTTCGCATCTTTCATTAAATAGCTTAGCGCTTATGAAAGGGGATGCT
GTTTCTCATGTTAAAGAGCTGTTGGCTTTATATAACTTACCGCAGTCAAAAGAAAATTATTTAATTATTG
AATCAATTAAAAAATTAGAATTTTCACTTACCCATAAACTTGTAGATGGCAAACCATTTCCAATGTTTGT
GAGAGGGGTAAAAGCTGAATTGCAAATTGATTCATCAGTGTTTAGAGGGCACAGCTTATATATTTTTAGT
CAACTATTAAGTCGTGTTTTTAATTTAAAGGTTCAAATTAATAGTTTTGTTGATTTGGTGGTTAAGGATT
ATTCATCTCAGCAGGAGTTATACCAATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTATAA