SecReT6
Protein ID: 507480529
SecReT6 ID792
T6SS typei4b
Gene symboltssG
Locus tagtssG
StrainAcinetobacter baumannii M2
Repliconchromosome [GenBank: KC432605] [Browse all T6SS(s) in this replicon]
Location [Strand]7563..8561 [+]
Producthypothetical protein
NoteTssG
UniProt IDR9RIP0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.50E-63, Aligned region: 18..312
Protein Sequence: 332 a.a.     [Download]
>gi|507480529|ref|AGM48623.1| hypothetical protein [Acinetobacter baumannii]
MQSERWWQDSSITAELFQRPKSFEFIQATRLLRHSPANDSFSSWTDHFKFETSFNLNFPATEIESLELVD
ERVHLTNLIVGLTGIQGALPYTYTNKIKQAPRQQRAETKEFLSLFNHKLTSQYVESSITYHLPVRYEIEN
KNDYLDILHALNGYVRSQHQQQDLDEYFAEFSGLMQGQNNTVHALKTMLSCIFKHEITIKEFIQESFKLA
SDQLTTLGGSQPSLLGINTFCGETIQQIDGKIEIQIGPLKRQQYLKFLPHQELSLKLKKIVETWCSPTLS
IDLRLILDESEIQPIRLTQSEESGLGQGAFLMSRKPSTHSHETCYSLIGEQI
 
Nucleotide Sequence: 999 bp     [Download]
>gi|507480521|gb|KC432605|tssG|:7563-8561
ATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTATAACGGCTGAGTTATTTCAACGCCCTAAATCTTTTG
AATTTATTCAAGCAACACGGTTATTGCGTCATAGCCCAGCTAATGATTCTTTTTCGTCGTGGACTGATCA
TTTTAAGTTTGAGACCTCATTTAACTTAAACTTTCCGGCCACTGAGATTGAAAGTTTAGAATTAGTAGAT
GAGCGTGTTCATTTAACAAACTTGATTGTTGGTCTTACTGGTATACAAGGTGCATTACCTTATACCTATA
CAAATAAAATTAAACAGGCTCCACGGCAGCAACGCGCTGAAACTAAAGAGTTTTTGAGTTTATTTAATCA
TAAGTTAACGAGTCAGTATGTCGAGTCAAGTATTACTTATCACTTGCCTGTGCGATATGAAATAGAAAAT
AAAAATGATTATTTAGATATTCTGCATGCTTTAAATGGTTATGTGAGATCACAACATCAACAACAAGATT
TAGATGAATATTTTGCCGAATTTTCAGGCTTAATGCAGGGGCAAAATAATACTGTTCATGCTTTGAAGAC
TATGTTGAGTTGTATATTTAAGCATGAAATTACAATTAAAGAGTTCATACAAGAATCATTTAAGTTAGCA
AGTGATCAGTTAACAACTTTGGGCGGAAGCCAGCCTAGCTTACTTGGTATAAATACGTTTTGTGGAGAAA
CGATTCAACAAATTGATGGAAAAATTGAGATTCAGATTGGTCCGCTTAAGCGTCAGCAATATTTAAAGTT
TTTACCTCATCAAGAGCTTAGTTTAAAGCTCAAAAAAATTGTAGAAACATGGTGCAGTCCAACTCTATCA
ATCGATTTAAGATTGATATTGGATGAGTCGGAAATACAACCCATTCGCCTAACTCAAAGCGAAGAAAGTG
GCTTAGGGCAAGGTGCTTTTTTAATGTCTCGCAAGCCTAGTACACATAGCCATGAAACATGTTATAGCCT
TATTGGAGAGCAAATATGA