SecReT6
Protein ID: 507480535
SecReT6 ID792
T6SS typei4b
Gene symboltssH
Locus tagtssH
StrainAcinetobacter baumannii M2
Repliconchromosome [GenBank: KC432605] [Browse all T6SS(s) in this replicon]
Location [Strand]16104..18788 [+]
ProductClpB
NoteTssH
UniProt IDR9RFN6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.00E-44, Aligned region: 230..308
AAA_2 [PF07724], Evalue: 6.00E-44, Aligned region: 607..775
AAA [PF00004], Evalue: 1.40E-22, Aligned region: 231..344
AAA [PF00004], Evalue: 1.40E-22, Aligned region: 612..729
AAA_5 [PF07728], Evalue: 1.90E-13, Aligned region: 231..253
AAA_5 [PF07728], Evalue: 1.90E-13, Aligned region: 611..729
AAA_16 [PF13191], Evalue: 9.80E-12, Aligned region: 17..73
AAA_16 [PF13191], Evalue: 9.80E-12, Aligned region: 208..253
AAA_16 [PF13191], Evalue: 9.80E-12, Aligned region: 275..310
AAA_16 [PF13191], Evalue: 9.80E-12, Aligned region: 482..515
AAA_16 [PF13191], Evalue: 9.80E-12, Aligned region: 606..655
AAA_16 [PF13191], Evalue: 9.80E-12, Aligned region: 677..705
ClpB_D2-small [PF10431], Evalue: 1.40E-11, Aligned region: 12..45
ClpB_D2-small [PF10431], Evalue: 1.40E-11, Aligned region: 170..201
ClpB_D2-small [PF10431], Evalue: 1.40E-11, Aligned region: 385..398
ClpB_D2-small [PF10431], Evalue: 1.40E-11, Aligned region: 781..851
Sigma54_activat [PF00158], Evalue: 1.80E-07, Aligned region: 228..249
Sigma54_activat [PF00158], Evalue: 1.80E-07, Aligned region: 608..715
AAA_22 [PF13401], Evalue: 2.80E-07, Aligned region: 230..324
AAA_22 [PF13401], Evalue: 2.80E-07, Aligned region: 455..504
AAA_22 [PF13401], Evalue: 2.80E-07, Aligned region: 608..638
AAA_14 [PF13173], Evalue: 4.30E-07, Aligned region: 231..334
AAA_14 [PF13173], Evalue: 4.30E-07, Aligned region: 609..694
AAA_19 [PF13245], Evalue: 6.30E-07, Aligned region: 231..251
AAA_19 [PF13245], Evalue: 6.30E-07, Aligned region: 607..633
AAA_17 [PF13207], Evalue: 1.50E-06, Aligned region: 231..306
AAA_17 [PF13207], Evalue: 1.50E-06, Aligned region: 467..496
AAA_17 [PF13207], Evalue: 1.50E-06, Aligned region: 610..648
NACHT [PF05729], Evalue: 2.00E-06, Aligned region: 231..328
NACHT [PF05729], Evalue: 2.00E-06, Aligned region: 611..640
AAA_25 [PF13481], Evalue: 2.40E-06, Aligned region: 231..303
AAA_25 [PF13481], Evalue: 2.40E-06, Aligned region: 607..637
AAA_25 [PF13481], Evalue: 2.40E-06, Aligned region: 837..866
IstB_IS21 [PF01695], Evalue: 4.60E-06, Aligned region: 225..291
IstB_IS21 [PF01695], Evalue: 4.60E-06, Aligned region: 611..631
Zeta_toxin [PF06414], Evalue: 3.60E-05, Aligned region: 231..251
Zeta_toxin [PF06414], Evalue: 3.60E-05, Aligned region: 606..651
AAA_18 [PF13238], Evalue: 4.30E-05, Aligned region: 67..127
AAA_18 [PF13238], Evalue: 4.30E-05, Aligned region: 231..261
AAA_18 [PF13238], Evalue: 4.30E-05, Aligned region: 475..544
AAA_18 [PF13238], Evalue: 4.30E-05, Aligned region: 612..641
RuvB_N [PF05496], Evalue: 0.00018, Aligned region: 230..249
RuvB_N [PF05496], Evalue: 0.00018, Aligned region: 301..311
RuvB_N [PF05496], Evalue: 0.00018, Aligned region: 575..633
RuvB_N [PF05496], Evalue: 0.00018, Aligned region: 680..705
Arch_ATPase [PF01637], Evalue: 0.00054, Aligned region: 63..98
Arch_ATPase [PF01637], Evalue: 0.00054, Aligned region: 158..207
Arch_ATPase [PF01637], Evalue: 0.00054, Aligned region: 210..244
Arch_ATPase [PF01637], Evalue: 0.00054, Aligned region: 283..380
Arch_ATPase [PF01637], Evalue: 0.00054, Aligned region: 472..490
Arch_ATPase [PF01637], Evalue: 0.00054, Aligned region: 607..657
RNA_helicase [PF00910], Evalue: 0.00057, Aligned region: 232..255
RNA_helicase [PF00910], Evalue: 0.00057, Aligned region: 612..633
AAA_29 [PF13555], Evalue: 0.00087, Aligned region: 224..247
AAA_29 [PF13555], Evalue: 0.00087, Aligned region: 606..622
AAA_29 [PF13555], Evalue: 0.00087, Aligned region: 715..738
DUF258 [PF03193], Evalue: 0.0017, Aligned region: 227..251
DUF258 [PF03193], Evalue: 0.0017, Aligned region: 590..636
T2SE [PF00437], Evalue: 0.0019, Aligned region: 216..250
T2SE [PF00437], Evalue: 0.0019, Aligned region: 423..460
T2SE [PF00437], Evalue: 0.0019, Aligned region: 583..680
TIP49 [PF06068], Evalue: 0.002, Aligned region: 231..254
TIP49 [PF06068], Evalue: 0.002, Aligned region: 279..311
TIP49 [PF06068], Evalue: 0.002, Aligned region: 611..646
AAA_28 [PF13521], Evalue: 0.0031, Aligned region: 231..306
AAA_28 [PF13521], Evalue: 0.0031, Aligned region: 611..631
AAA_33 [PF13671], Evalue: 0.0058, Aligned region: 232..302
AAA_33 [PF13671], Evalue: 0.0058, Aligned region: 610..633
DUF2075 [PF09848], Evalue: 0.0062, Aligned region: 231..333
DUF2075 [PF09848], Evalue: 0.0062, Aligned region: 610..642
MobB [PF03205], Evalue: 0.0073, Aligned region: 232..265
MobB [PF03205], Evalue: 0.0073, Aligned region: 610..641
Protein Sequence: 894 a.a.     [Download]
>gi|507480535|ref|AGM48629.1| ClpB [Acinetobacter baumannii]
MMSSLKILITKLSTVARTALEKSANACVLQQNYEIEIEHLFLELLNQSLENDLKILLKKYKISADALADD
LKETISQLPKGNTRTPIFAKSIVRLFEQAWLLASAEQNPVIRSGHLLVALLTAPDLYQIATRASSLFDLL
PIDSMKHKFLEICEKSVEQQEEPKTSSQEEDELEQVATPNVKTQKTPALDQYTINLTEKAKNGGIDPVIG
REFEIRLMLDILMRRRQNNPILTGEPGVGKTAVVEGLALKIAQGLVPEALKNVHLHVLDMGLLQAGASVK
GEFENRLKQVIQEVQASAHPIILFIDEAHTLIGAGGQAGQNDAANLLKPALARGELRTIAATTWAEYKQY
FEKDAALSRRFQVVKVEEPTEEVAVDMLRAMIPVMQKHFNLQIDDEAIITAVHASHRYISGRQLPDKAVS
VLDTAAARVALTQNAQPVKLDQLKAQEHNLKLEQQILENEHRQIPIHHERLENLKNHLESLQNEIQETQE
QWQKELELVRKIQELEAQSHSNESEAYDQINLMRKDLADIQGQQPLVFERVNSQIINEIISDWTGIPVGK
MVNDEIKQILTLEDKLGERVMGQDYALTQLVQGIKTSKAKLEDPNKPQGVFLLVGPSGVGKTETAITLAN
ELYGGEQHLITINMSEYQEAHTVSSLKGAPPGYVGYGQGGVLTEAVRRNPYSVVLLDEIEKAHSDVQELF
YQVFDKGTLEDGEGRVIDFKNTTILLTSNAGSSAIMQACLNQPVEEWPTAEELIEHLKPNLYKQFKPAFL
GRMRVVPYFPLHDDLLVRIIKHKLGKITARIEKQYGTAVQYSEDLVELLLSRCTEVDSGARNVDNILNST
VLPALATEILVALADQKLPKVIMIDAKDDEIQYLLDPVAKPAKKRTSKKLKSEV
 
Nucleotide Sequence: 2685 bp     [Download]
>gi|507480521|gb|KC432605|tssH|:16104-18788
ATGATGAGTAGTTTAAAAATTTTAATTACAAAACTTTCTACAGTTGCGCGCACTGCTTTAGAAAAATCGG
CTAATGCTTGTGTCCTTCAGCAAAACTACGAAATTGAAATTGAACATTTATTTTTAGAGCTACTTAATCA
GTCTTTAGAAAATGATTTAAAAATTTTATTAAAAAAATATAAAATCTCAGCTGATGCTTTGGCAGATGAT
TTAAAAGAGACAATCTCTCAATTACCAAAAGGTAATACACGTACTCCAATTTTTGCTAAATCCATTGTTC
GTTTATTTGAGCAAGCTTGGTTATTGGCTTCGGCAGAACAAAACCCTGTCATTCGTAGTGGTCATTTGTT
AGTTGCATTATTAACTGCGCCAGATTTATATCAAATTGCAACAAGAGCTTCGAGTTTATTTGATCTTTTA
CCGATAGACTCGATGAAACATAAGTTTCTTGAGATTTGTGAAAAGAGTGTAGAACAACAAGAAGAACCTA
AAACTTCTTCACAAGAAGAAGATGAGCTAGAACAAGTTGCTACTCCAAATGTAAAAACTCAAAAAACACC
AGCTTTAGATCAATATACAATTAATTTAACTGAAAAAGCGAAGAATGGTGGAATTGATCCAGTTATTGGG
CGTGAATTTGAAATTCGTTTAATGCTCGATATTTTAATGCGCAGACGCCAAAATAACCCGATTTTAACTG
GCGAACCTGGTGTAGGTAAAACAGCTGTAGTTGAAGGGCTAGCTTTAAAAATTGCTCAAGGTTTAGTTCC
TGAGGCTTTAAAAAATGTACATTTGCATGTTTTAGATATGGGCCTTTTACAAGCAGGTGCAAGTGTTAAA
GGTGAGTTTGAAAACCGTTTAAAACAAGTGATTCAGGAAGTTCAGGCTTCGGCTCATCCTATTATTTTAT
TCATTGATGAAGCACATACGCTTATTGGTGCAGGTGGCCAAGCAGGGCAAAACGATGCTGCTAACCTTTT
AAAACCTGCACTTGCACGTGGTGAGCTACGAACGATTGCTGCAACAACATGGGCTGAATATAAACAGTAT
TTTGAAAAAGATGCTGCCTTAAGCCGCCGTTTTCAGGTCGTAAAGGTTGAAGAGCCGACCGAAGAAGTTG
CTGTTGATATGCTACGTGCAATGATTCCAGTAATGCAAAAGCACTTTAATTTACAAATTGATGATGAAGC
AATTATCACAGCTGTACATGCTTCTCATCGCTATATTAGTGGTCGTCAACTCCCGGATAAAGCAGTAAGT
GTTCTTGATACTGCAGCAGCACGTGTAGCGTTGACCCAAAATGCACAGCCAGTCAAACTTGATCAATTGA
AGGCACAAGAACATAACTTAAAGCTTGAGCAACAGATTTTGGAAAATGAACATCGTCAGATTCCAATACA
CCATGAACGATTAGAGAATCTGAAGAATCATTTAGAGTCTTTACAAAACGAGATTCAAGAAACTCAGGAA
CAATGGCAAAAAGAATTAGAGCTAGTTCGTAAAATTCAGGAATTAGAAGCGCAAAGCCATTCTAATGAGT
CTGAAGCCTATGATCAGATTAATTTAATGCGCAAAGATCTTGCTGATATTCAAGGTCAACAGCCATTAGT
TTTTGAGCGTGTAAATTCTCAAATTATTAATGAAATTATTTCTGATTGGACCGGTATTCCTGTTGGGAAA
ATGGTAAATGATGAAATTAAGCAAATCTTAACGCTTGAAGATAAATTGGGCGAGCGTGTAATGGGCCAAG
ATTATGCACTCACACAATTGGTTCAAGGTATTAAAACATCAAAGGCTAAATTAGAAGATCCAAATAAACC
TCAAGGTGTATTCCTTTTAGTTGGCCCTAGCGGGGTGGGTAAGACTGAAACCGCAATTACCTTAGCAAAT
GAGCTGTATGGTGGTGAGCAGCATTTAATCACGATTAATATGTCTGAATATCAAGAAGCGCATACGGTAT
CTTCACTTAAAGGTGCACCTCCAGGATATGTGGGCTATGGTCAAGGCGGTGTGTTAACCGAAGCAGTACG
CCGTAATCCTTATAGTGTTGTACTACTCGACGAAATTGAAAAAGCACATAGCGATGTGCAAGAGCTGTTC
TACCAAGTATTTGATAAAGGTACTTTAGAAGATGGTGAAGGTCGTGTTATTGATTTTAAAAACACGACAA
TTTTATTAACTTCAAATGCTGGTTCTAGTGCAATTATGCAGGCATGTTTAAATCAGCCTGTTGAAGAGTG
GCCTACAGCAGAAGAGTTAATTGAGCATTTAAAACCAAATTTATATAAACAATTTAAACCAGCCTTTTTA
GGACGTATGAGAGTTGTGCCATATTTCCCGTTGCATGACGATTTATTGGTTCGAATTATTAAACACAAGT
TGGGCAAAATTACCGCTCGAATCGAAAAACAATATGGAACAGCAGTCCAATATTCAGAGGATTTAGTCGA
GTTACTACTTAGCCGTTGTACTGAAGTGGATAGTGGCGCCCGTAATGTCGATAACATCTTAAATTCGACA
GTTTTACCCGCTTTGGCAACTGAAATTTTAGTGGCGTTAGCAGATCAAAAATTGCCGAAAGTAATCATGA
TTGATGCCAAAGATGATGAAATCCAATATTTACTAGATCCTGTAGCGAAGCCTGCTAAAAAACGGACTAG
TAAAAAGTTGAAATCAGAAGTTTAA