SecReT6
Protein ID: 507480536
SecReT6 ID792
T6SS typei4b
Gene symboltssA
Locus tagtssA
StrainAcinetobacter baumannii M2
Repliconchromosome [GenBank: KC432605] [Browse all T6SS(s) in this replicon]
Location [Strand]18810..19904 [+]
Producthypothetical protein
NoteTssA
UniProt IDR9RIQ1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.30E-22, Aligned region: 55..114
Protein Sequence: 364 a.a.     [Download]
>gi|507480536|ref|AGM48630.1| hypothetical protein [Acinetobacter baumannii]
MSIDISELLKPINDSLLCGEDYSFSNEFHEIKKARTEDDLLLDQGDWVAERKQADWDFVAKSVSNLLTEK
TKDIRLLTWLIEAWTHLNGFEGMVKGLTLTHTMLNQYWQDIHPIIEDDDLDQRIGLLQGLINQLPGLLKK
VSLTNTAPYYNLLDYDNFLYHENIRRKQTEEYDSQSGPSELEQFDQAIFNTSKTFQYSNYQEFTSVLTEW
NVLKQTLDHLMGLDAPSFAANDSAFETIHSTLRKIYKAEAFGSGLAQTQEQAAVITTPSMENQVPVQIVS
EQPMFQPQAQTHLANREQAMKVLQEIADYFQANEPHSPVSYMLQKTIKWSQMPLHEWLAQVIKDENPLQM
VQEMLGVQPKNEYE
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|507480521|gb|KC432605|tssA|:18810-19904
ATGAGTATTGATATTTCTGAACTACTTAAACCCATTAATGACAGCTTACTTTGTGGAGAGGATTATTCAT
TTTCTAATGAATTTCACGAAATAAAGAAAGCGAGAACTGAGGATGATCTATTATTAGATCAGGGGGATTG
GGTTGCTGAGCGGAAACAGGCAGATTGGGATTTTGTCGCAAAGAGCGTCAGTAATTTGCTCACAGAAAAA
ACCAAAGATATCCGTCTATTAACATGGTTAATAGAAGCCTGGACTCATCTAAATGGCTTTGAGGGTATGG
TAAAGGGTTTAACTTTAACCCATACCATGCTGAACCAATATTGGCAGGATATTCATCCGATTATTGAAGA
TGATGATTTAGACCAACGTATTGGTTTATTACAAGGTTTAATTAATCAGTTGCCTGGTTTGTTGAAGAAA
GTATCTTTAACTAACACAGCGCCTTATTACAACTTACTTGATTACGATAATTTTCTATACCACGAAAACA
TTCGTCGTAAGCAAACAGAAGAGTACGACAGCCAATCAGGTCCATCTGAATTGGAACAATTTGATCAAGC
GATTTTTAATACGTCTAAAACCTTTCAATATTCAAATTATCAAGAGTTTACTTCAGTTCTAACGGAGTGG
AATGTTTTAAAACAGACGCTTGATCACTTAATGGGATTAGATGCACCAAGTTTTGCTGCAAATGATTCTG
CATTTGAAACCATTCACAGCACCTTACGCAAGATTTATAAAGCAGAGGCTTTTGGTAGTGGGCTTGCCCA
AACCCAAGAACAGGCCGCTGTTATTACGACTCCATCTATGGAAAATCAAGTGCCTGTACAAATCGTATCA
GAACAGCCTATGTTTCAGCCTCAAGCACAAACTCACTTGGCTAACCGTGAGCAAGCAATGAAAGTGCTAC
AAGAAATAGCCGATTATTTTCAGGCCAATGAACCACATAGTCCTGTGAGTTATATGCTTCAAAAGACCAT
TAAATGGAGTCAAATGCCATTACATGAATGGTTGGCACAAGTCATTAAAGATGAAAATCCATTACAAATG
GTTCAGGAAATGTTAGGTGTGCAGCCTAAAAATGAATATGAATAA