SecReT6
Protein ID: 507480537
SecReT6 ID792
T6SS typei4b
Gene symboltssK
Locus tagtssK
StrainAcinetobacter baumannii M2
Repliconchromosome [GenBank: KC432605] [Browse all T6SS(s) in this replicon]
Location [Strand]19921..21285 [+]
Producthypothetical protein
NoteTssK
UniProt IDR9RHI9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.50E-125, Aligned region: 19..451
Protein Sequence: 454 a.a.     [Download]
>gi|507480537|ref|AGM48631.1| hypothetical protein [Acinetobacter baumannii]
MFKAEKVLWGEGLFLRPQHFQIQDTYHEQRLNHTVRAVVPFSYGVQKLSFDEAQLSTHILALETVEMIWQ
DGEIYQAPAYDLLPEPILLDELNLRGEMVIYLALPLLQANKQNLIDQNQSQKGRYQSHLVETHDLFTNAT
EADISLLRRRAVFKLLDVNSNPDHNLDGFLYLPIGKIKRQSSGAFEIDRKFIPPILHVDASETLVSNLKR
TLNVIKAKIKTIQTNNRENEQKLIEFRSGDIVSFWLVNALNTAHAGLNHFLQYPQIHPERLFFELLRLAG
SLLTFSTAYEVDQLPAYKHHNLQESFTQLDTILRDLLDTIISSRYISIALKEIRPSYWVGSLETDKITRD
TRLYIAVSSSAMQTHELIQIVPLRFKIGSTLDVEQRVVAALPAIPLHHLIQVPTAIPVRSGVSYFEIEPH
HELYQRMLDSETICIYVPAGFQDISIELIAVMNA
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|507480521|gb|KC432605|tssK|:19921-21285
ATGTTTAAAGCTGAAAAAGTCCTGTGGGGCGAAGGTTTATTTTTAAGACCTCAACATTTCCAAATTCAAG
ATACCTATCATGAACAACGCTTAAATCACACTGTTCGTGCTGTTGTGCCGTTTTCATATGGTGTTCAAAA
ATTAAGTTTTGATGAAGCACAGCTTAGTACACATATTCTTGCGCTTGAAACGGTAGAAATGATTTGGCAA
GACGGTGAAATATATCAGGCACCGGCTTACGATTTATTACCTGAACCAATTTTGCTTGATGAGCTTAATT
TACGTGGTGAAATGGTCATCTATTTGGCATTACCATTATTACAAGCCAATAAACAGAATTTAATTGATCA
GAATCAATCACAGAAGGGGCGTTATCAATCACATTTGGTTGAGACCCACGATCTGTTCACAAATGCGACA
GAAGCAGATATCAGTTTGTTACGTCGTCGAGCTGTGTTTAAATTATTAGATGTGAACAGCAATCCTGATC
ATAATCTGGATGGTTTTCTTTATTTGCCAATAGGTAAAATCAAACGTCAGAGTTCAGGTGCTTTTGAAAT
TGATCGTAAATTTATTCCACCTATTTTGCATGTCGATGCATCTGAGACATTAGTTTCGAATTTAAAAAGA
ACATTGAATGTTATTAAGGCAAAAATTAAAACCATTCAAACCAACAACCGTGAAAATGAACAGAAATTAA
TTGAATTCCGTTCAGGTGATATCGTTTCGTTTTGGTTAGTCAATGCTTTAAACACTGCACATGCTGGTCT
GAATCATTTCCTGCAATATCCACAAATTCATCCGGAACGATTGTTTTTTGAATTATTGCGTTTAGCGGGC
TCATTATTAACTTTTTCGACAGCTTATGAAGTTGATCAGTTACCGGCCTATAAACATCACAATTTGCAAG
AGAGCTTTACTCAGCTCGACACCATTTTGCGTGATTTATTAGATACCATTATTTCTAGTCGCTACATCAG
TATTGCCCTTAAAGAAATTCGACCTTCATATTGGGTGGGAAGCCTCGAGACAGATAAGATTACTCGTGAT
ACTAGACTTTATATAGCCGTATCTAGCAGTGCAATGCAGACTCACGAGTTGATTCAGATTGTACCTCTAC
GGTTTAAAATCGGTAGTACGCTGGATGTTGAACAGCGTGTTGTTGCAGCATTACCAGCCATTCCATTACA
CCACTTAATTCAAGTTCCAACGGCTATTCCAGTGCGTTCTGGCGTGAGCTATTTCGAAATCGAACCGCAT
CATGAACTCTATCAGCGCATGTTAGATTCAGAGACGATTTGTATTTACGTTCCAGCGGGCTTCCAAGATA
TCAGTATTGAGCTGATTGCGGTCATGAACGCTTAA