SecReT6
Protein ID: 507480538
SecReT6 ID792
T6SS typei4b
Gene symboltssL
Locus tagtssL
StrainAcinetobacter baumannii M2
Repliconchromosome [GenBank: KC432605] [Browse all T6SS(s) in this replicon]
Location [Strand]21303..22109 [+]
Productputative transmembrane protein
NoteTssL
UniProt IDR9RHK3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.90E-53, Aligned region: 34..239
Protein Sequence: 268 a.a.     [Download]
>gi|507480538|ref|AGM48632.1| putative transmembrane protein [Acinetobacter baumannii]
MSQSTGAPSLFDDGQIGTGGNNNSQSQAKLQAINLIDLLHDGFYLIFLIRNQYVPADPQRFREKILDLLN
RFEQQAKKLQFSADDIHDAKYAFCALIDETIVTQQDPSYFNLQNAWLISPLQLSLFGSQLAGYQFFEILE
QLRSRGKDRLAALEVFHYCLLLGFQGKYRIESIESLNHLVARVGDEIDYLKGKKVAFSPFSAIPDQIRNI
IHRELPFFWILIFLLIFALLTFAGLRFMLNNQNDKALSTYQNVISAPQEQAHITIYLP
 
Nucleotide Sequence: 807 bp     [Download]
>gi|507480521|gb|KC432605|tssL|:21303-22109
ATGTCACAATCTACAGGTGCTCCTTCTTTATTTGATGATGGGCAAATCGGGACAGGGGGAAATAATAATA
GCCAGTCCCAAGCAAAACTACAGGCGATTAATCTGATCGATTTATTGCACGATGGTTTTTATTTAATCTT
TTTGATTCGAAATCAGTATGTGCCAGCTGACCCGCAGCGGTTTCGTGAAAAGATTTTAGATTTGCTTAAT
CGATTTGAACAACAAGCTAAAAAGTTGCAGTTTTCAGCAGATGATATTCATGATGCTAAATATGCATTTT
GTGCATTGATTGATGAAACAATCGTGACCCAACAAGACCCAAGCTATTTTAATTTGCAAAATGCTTGGTT
GATTAGTCCGTTGCAATTGAGCTTATTTGGTTCTCAATTGGCGGGTTATCAGTTCTTCGAAATATTAGAA
CAGCTGAGAAGCCGTGGAAAAGATCGTTTAGCTGCTCTTGAAGTATTCCATTACTGTCTATTATTAGGTT
TTCAGGGTAAATATCGAATTGAGTCTATCGAAAGCTTAAATCATTTGGTTGCGCGAGTAGGTGACGAAAT
TGATTATTTAAAAGGTAAAAAAGTTGCTTTTTCGCCGTTCTCGGCAATTCCCGATCAGATACGAAATATT
ATTCATCGCGAATTACCTTTTTTCTGGATTTTGATTTTCTTATTGATTTTTGCATTGCTTACCTTCGCGG
GTCTAAGATTTATGTTGAACAATCAAAATGATAAAGCATTATCTACTTATCAAAATGTGATTTCTGCCCC
ACAAGAGCAGGCACATATTACAATTTATTTACCTTGA