SecReT6
Protein ID: 507514868
SecReT6 ID765
T6SS typeN/A
Gene symbol-
Locus tagBRPE64_ACDS03350
StrainBurkholderia sp. RPE64
Repliconchromosome I [GenBank: NC_021287] [Browse all T6SS(s) in this replicon]
Location [Strand]337535..339031 [+]
Producthypothetical protein
NoteTssC
UniProt IDR4WF77
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.40E-193, Aligned region: 66..492
Protein Sequence: 498 a.a.     [Download]
>gi|507514868|ref|YP_008036485.1| putative uncharacterized protein [Burkholderia sp. RPE64]
MTKKAAQAAEAQTTYAQSDFTQLLEKEFRSKTEHAREAVELAVKTLAEQALSQSLTISDDAYKSIAAIIA
QIDHKLSEQINLILHHADFQQLESAWRGLHHLVSNTETDEHLKIRFMDLSKTELHRTMRRYKGVAWDQSP
LFKQIYEEEYGQLGGEPYGCLVADYFFDHTPPDVDLLGSIAKVAASSHTPFIAGAAPSVLQMESWQELAN
PRDLTKIFTQNLEYTAWNSLRNTEDARYIGLAMPRFLARLPYGAKTNPVDEFDFEEETNGSDHNRYAWAN
AAYAMGVNINRSFKEYGWCSLIRGVESGGTVENLPTHTFPTDDGGIDMKCPTEIAISDRREAELSKSGFI
PLIHRKNTDHATFIGAQSLQKPAEYHDPDATANANLSARLPYLFACSRFAHYLKCIVRDKVGSFREREDM
QRWLNEWVMHYVDADPVNSSQDTKARRPLAAAEVMVEEMEGNPGYYQAKFFLRPHFQLEGLTVSLRLVTK
LPSIKDAA
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|507514533|ref|NC_021287.1|:337535-339031 Burkholderia sp. RPE64 DNA, chromosome 1, complete genome
ATGACGAAAAAAGCAGCACAAGCCGCTGAAGCTCAGACAACGTACGCACAATCCGATTTCACGCAGCTTC
TCGAAAAGGAATTCCGTTCTAAGACGGAGCATGCTCGCGAAGCCGTCGAACTCGCGGTCAAGACGCTTGC
TGAGCAGGCGCTGTCGCAGTCGCTCACGATCAGTGACGACGCATACAAGAGCATTGCCGCGATCATCGCG
CAGATCGATCATAAGCTTTCCGAACAGATCAATCTGATCCTGCATCATGCCGACTTCCAGCAGCTCGAAT
CGGCTTGGCGCGGTCTGCATCACCTTGTCTCGAACACGGAAACCGACGAGCATCTGAAGATCCGCTTCAT
GGATTTGTCGAAGACGGAGCTGCATCGCACAATGCGCCGATACAAGGGCGTTGCGTGGGATCAAAGCCCC
CTCTTCAAGCAGATCTACGAAGAAGAATACGGCCAGCTCGGCGGCGAGCCTTATGGCTGCCTCGTCGCAG
ATTATTTCTTCGACCACACGCCCCCGGATGTCGATCTGCTCGGTTCCATCGCGAAGGTCGCTGCGTCGTC
GCATACGCCGTTCATCGCGGGCGCAGCGCCTTCCGTGCTTCAGATGGAATCGTGGCAGGAACTCGCGAAC
CCGCGAGACCTGACGAAGATCTTCACGCAGAACCTCGAATACACGGCCTGGAACTCGCTGCGCAACACCG
AGGACGCGCGTTACATCGGCCTCGCCATGCCACGCTTTCTCGCACGTCTGCCGTACGGCGCGAAGACCAA
CCCGGTCGATGAATTCGATTTCGAAGAAGAAACCAACGGTTCGGATCACAACCGCTACGCATGGGCCAAT
GCGGCGTATGCCATGGGCGTGAACATCAACCGCTCGTTCAAGGAATACGGCTGGTGCTCGCTGATTCGCG
GAGTCGAGTCGGGCGGAACGGTCGAGAACCTGCCGACGCACACGTTTCCGACCGACGACGGCGGCATCGA
CATGAAGTGCCCGACCGAAATCGCGATCTCGGATCGCCGCGAAGCAGAACTGTCGAAGAGCGGCTTCATT
CCGCTGATCCACCGCAAGAACACGGATCACGCAACGTTCATCGGCGCGCAGTCGTTGCAAAAACCCGCCG
AGTATCACGACCCTGACGCGACCGCCAACGCGAATCTGTCGGCGCGTCTGCCGTATCTGTTCGCTTGCTC
GCGTTTCGCGCACTACCTGAAGTGCATCGTGCGCGACAAGGTTGGCTCCTTCCGTGAACGCGAAGACATG
CAGCGTTGGCTGAACGAATGGGTCATGCATTACGTGGATGCAGACCCGGTCAACTCGTCGCAGGACACGA
AAGCGCGCCGACCGCTGGCCGCCGCGGAAGTGATGGTCGAGGAAATGGAAGGCAACCCTGGCTATTACCA
AGCGAAGTTCTTCCTGCGTCCGCATTTCCAACTCGAAGGTCTGACCGTGTCGCTGCGGCTGGTCACGAAG
TTGCCCTCGATCAAGGATGCTGCGTAA