SecReT6
Protein ID: 507514869
SecReT6 ID765
T6SS typeN/A
Gene symbol-
Locus tagBRPE64_ACDS03360
StrainBurkholderia sp. RPE64
Repliconchromosome I [GenBank: NC_021287] [Browse all T6SS(s) in this replicon]
Location [Strand]339157..339642 [+]
Producttype VI secretion system effector Hcp1 family
NoteTssD
UniProt IDR4WMJ1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.90E-43, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|507514869|ref|YP_008036486.1| type VI secretion system effector Hcp1 family [Burkholderia sp. RPE64]
MAQDIFLKIDGITGESLDDKHKDEIEVLNWNWEIRQESTMHSGSGGGAGKASVSDLVFEHNIDRSSPNLM
KYALTGKHIDAATLVMRKAGGSPLEYLKITMHDVLVTRVAPSGSRNDSDKSRESVSLSFSKVKQEYVVQN
AQGGSGGAVTAGFDIKGNKEA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|507514533|ref|NC_021287.1|:339157-339642 Burkholderia sp. RPE64 DNA, chromosome 1, complete genome
ATGGCACAGGACATTTTCTTGAAGATCGACGGTATTACCGGCGAGTCGCTGGACGACAAGCACAAGGACG
AAATCGAAGTCCTGAACTGGAACTGGGAAATCCGCCAGGAATCCACGATGCACTCGGGTAGCGGCGGCGG
TGCGGGCAAGGCATCGGTGTCGGACCTCGTGTTCGAACACAACATCGATCGTTCGAGCCCCAACCTGATG
AAGTACGCCCTGACCGGCAAGCACATCGATGCGGCAACGCTGGTGATGCGCAAGGCTGGCGGTAGCCCGC
TGGAATACCTGAAGATCACGATGCACGACGTGCTCGTGACGCGCGTGGCGCCGTCGGGCAGCCGTAACGA
TAGCGACAAGAGCCGCGAAAGCGTCTCGCTGTCGTTCTCGAAGGTCAAGCAGGAATACGTCGTCCAGAAC
GCCCAGGGCGGTTCGGGCGGTGCGGTGACGGCTGGCTTTGACATCAAGGGCAACAAGGAAGCGTAA