SecReT6
Protein ID: 507514870
SecReT6 ID765
T6SS typeN/A
Gene symbol-
Locus tagBRPE64_ACDS03370
StrainBurkholderia sp. RPE64
Repliconchromosome I [GenBank: NC_021287] [Browse all T6SS(s) in this replicon]
Location [Strand]339754..340269 [+]
Producthypothetical protein
NoteTssJ
UniProt IDR4WT54
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.10E-40, Aligned region: 14..160
Protein Sequence: 171 a.a.     [Download]
>gi|507514870|ref|YP_008036487.1| putative uncharacterized protein [Burkholderia sp. RPE64]
MRSILIAAALMSALWLSACASSSDPKPKEPVRLELKVTVQNDVNPDDKGRAAPIVVRIYELKNDVAFKSA
DFFTLQTQDKTLLANDLVRRDQLQLRPGDTKNIFRIGDPETTTIGVIAAYRDLPNAVWRETYTLPTAPDA
AWYHFTPKVQLTINLEAKAVKIAETKKPEKK
 
Nucleotide Sequence: 516 bp     [Download]
>gi|507514533|ref|NC_021287.1|:339754-340269 Burkholderia sp. RPE64 DNA, chromosome 1, complete genome
ATGCGTTCGATCCTGATCGCCGCCGCACTGATGAGCGCGCTATGGCTCTCGGCCTGCGCCAGTAGCAGCG
ACCCAAAGCCGAAGGAGCCGGTCCGGCTTGAGCTGAAGGTCACTGTGCAGAACGACGTCAATCCCGACGA
CAAGGGCCGCGCCGCGCCCATCGTCGTGCGCATCTACGAGTTGAAGAACGATGTCGCGTTCAAGAGCGCC
GACTTCTTTACGTTGCAGACGCAGGACAAGACCTTGCTCGCCAATGACCTCGTCAGACGCGACCAGCTCC
AGTTGCGACCGGGCGACACCAAGAACATCTTTCGGATCGGCGATCCGGAGACGACCACCATCGGCGTGAT
CGCGGCTTATCGGGATCTGCCCAACGCCGTATGGCGCGAGACCTATACGCTGCCGACGGCGCCCGACGCC
GCGTGGTACCACTTCACCCCCAAAGTTCAACTGACGATCAACCTGGAGGCGAAGGCCGTGAAGATCGCCG
AAACCAAGAAGCCGGAAAAGAAGTAA