SecReT6
Protein ID: 507514871
SecReT6 ID765
T6SS typeN/A
Gene symbol-
Locus tagBRPE64_ACDS03380
StrainBurkholderia sp. RPE64
Repliconchromosome I [GenBank: NC_021287] [Browse all T6SS(s) in this replicon]
Location [Strand]340640..341119 [+]
Producthypothetical protein
NoteTssE
UniProt IDR4WW00
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.30E-20, Aligned region: 25..137
Protein Sequence: 159 a.a.     [Download]
>gi|507514871|ref|YP_008036488.1| putative uncharacterized protein [Burkholderia sp. RPE64]
MPTLLDRLRDDVPRRQGESPEEYAVSRKQMRDIIQRDLIYLLNTTNIEDQIDRKRYPEAAKSTINFGVPP
LAGEFLAARQWTDVEQTIRAVIERFEPRLMKDSLVIRVLESGAAIAHHNVLSFEVRGEIHMDPYPLEFMV
QSSLDLETSQINVTGARTD
 
Nucleotide Sequence: 480 bp     [Download]
>gi|507514533|ref|NC_021287.1|:340640-341119 Burkholderia sp. RPE64 DNA, chromosome 1, complete genome
ATGCCGACACTGCTCGATCGCCTGCGCGATGACGTGCCGCGCCGGCAGGGCGAGTCGCCCGAAGAGTACG
CGGTCTCGCGCAAGCAAATGCGCGACATCATTCAGCGCGATCTGATCTATCTGCTCAACACGACGAACAT
CGAAGATCAGATCGACCGCAAGCGCTATCCCGAGGCGGCTAAATCGACTATTAATTTCGGCGTGCCGCCG
CTCGCCGGGGAGTTTCTCGCGGCGCGTCAGTGGACCGATGTCGAGCAGACCATCCGCGCCGTGATCGAGC
GTTTCGAGCCGCGCCTCATGAAGGATTCGCTCGTCATCCGCGTGCTCGAAAGTGGCGCTGCGATAGCGCA
TCACAACGTGCTCTCGTTCGAGGTGCGCGGAGAAATCCACATGGACCCTTACCCGCTGGAATTCATGGTG
CAGAGTTCGCTGGATCTGGAGACGAGTCAGATCAATGTCACGGGGGCGCGTACGGATTGA