SecReT6
Protein ID: 507514872
SecReT6 ID765
T6SS typeN/A
Gene symbol-
Locus tagBRPE64_ACDS03390
StrainBurkholderia sp. RPE64
Repliconchromosome I [GenBank: NC_021287] [Browse all T6SS(s) in this replicon]
Location [Strand]342635..344527 [+]
Producthypothetical protein
NoteTssF
UniProt IDR4WEZ9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.10E-216, Aligned region: 5..629
Protein Sequence: 630 a.a.     [Download]
>gi|507514872|ref|YP_008036489.1| putative uncharacterized protein [Burkholderia sp. RPE64]
MDPRLLDYYNQELIYMRELGAEFAQAHPKIARRLGMQAGEVADPYVERLIESFCFMAARTQLKLDAEFPR
FTGRLLEVVYPNYVAPTPSIAVAQVFPGGQAGNLVKGYDVPRGTRFTASAPKGEKTECTFTTGHDVKMWP
VRITEARLTGVPPDIPSLGRYVPPDRQVRGALRLTLATTGDFGFSEIKGLDRLPVYLAGDEQVASHLYEL
VHASSLAAAIAPPGMFGSATTRPSFVTEGAVEHDGLRADQNLLPLTWTKFHGHNLLHEYFACPARFLFFA
LNGLAEGLSRIGGREAEIVILLDRAPGHLANLVDAARFALFCTPIINLFEKRTDRVTLTPGETECHVVPA
RLLPLDYEVFSVQTVYGQVEVDSVELPFRPLYQTLNNDEGNHGRYFSTRRERRLHSDSSRRYGTRTPYIG
TEMFLSLVDQKEAPYPEGIRYISVDALVTNRDLATLVPRNGVTDLTADKASGPIASIGLIRAPSAPRPPY
ADREMAWRLIRQLNFNYLALEDQDHRPGGQALRDLLRLYVMDDDTDHQRQIEGLVGVKTRPVTRKLSGKG
PMTFGRGIECALTIDETGFSGISPYLFGLILEHWLARHVSINSFTQTELHSMQRGKVMTWPVRTGTRGVV
 
Nucleotide Sequence: 1893 bp     [Download]
>gi|507514533|ref|NC_021287.1|:342635-344527 Burkholderia sp. RPE64 DNA, chromosome 1, complete genome
ATGGATCCCCGACTGCTCGACTACTACAACCAGGAACTGATCTACATGCGCGAACTCGGCGCCGAGTTTG
CGCAGGCACATCCCAAGATTGCTCGTCGGCTCGGGATGCAAGCCGGCGAAGTCGCCGACCCGTATGTCGA
GCGGCTGATCGAGTCATTCTGTTTCATGGCCGCGCGCACGCAACTGAAACTCGATGCCGAGTTCCCCCGC
TTCACCGGCAGGCTGCTTGAAGTCGTCTACCCGAACTATGTGGCGCCGACGCCGTCCATCGCGGTCGCGC
AGGTCTTTCCGGGCGGTCAGGCCGGCAATCTCGTGAAGGGCTACGACGTGCCGCGTGGCACGCGCTTCAC
CGCGTCCGCGCCCAAAGGAGAGAAGACCGAGTGCACGTTCACGACCGGTCACGACGTCAAGATGTGGCCG
GTTCGGATCACCGAGGCGCGTCTAACCGGCGTGCCGCCGGACATTCCGTCGCTCGGCCGCTACGTGCCGC
CGGACCGGCAAGTGCGCGGCGCGCTTCGTCTGACATTGGCGACCACGGGCGACTTCGGCTTCTCGGAGAT
CAAGGGCCTCGACCGTCTGCCCGTCTATCTGGCAGGCGATGAACAGGTCGCGTCGCATTTATACGAACTC
GTGCATGCGTCGAGTCTGGCTGCCGCGATCGCGCCGCCCGGCATGTTCGGATCTGCGACGACTCGTCCGT
CCTTCGTCACCGAAGGCGCGGTCGAACACGACGGCTTGCGCGCCGATCAGAATTTGCTGCCGCTGACGTG
GACCAAGTTCCACGGTCACAATCTGCTGCACGAGTACTTTGCCTGTCCTGCGCGCTTTCTCTTCTTCGCG
CTCAACGGTCTGGCTGAGGGGCTTTCACGTATCGGTGGCCGGGAAGCCGAGATCGTCATTTTGCTGGACC
GCGCTCCGGGCCATCTGGCCAATCTCGTCGATGCCGCACGCTTCGCGCTCTTCTGCACGCCGATCATCAA
CCTGTTCGAGAAGCGCACCGACCGCGTGACGCTCACGCCGGGCGAAACCGAATGTCATGTGGTGCCCGCA
CGGTTATTGCCGCTCGACTACGAAGTGTTCTCGGTGCAGACGGTCTATGGACAAGTCGAGGTCGATTCCG
TGGAGCTGCCGTTCAGACCGCTCTATCAGACCCTGAACAACGACGAAGGCAATCACGGCCGCTATTTTTC
GACGCGACGCGAACGCCGGCTGCATTCGGACTCTTCGCGCCGCTATGGGACGCGTACGCCTTATATCGGC
ACGGAAATGTTCCTGTCGCTCGTCGATCAGAAGGAAGCGCCATATCCGGAGGGAATCCGCTACATCTCTG
TCGATGCGCTTGTCACCAACCGCGATCTCGCCACGCTCGTGCCACGCAATGGTGTGACGGATCTTACGGC
CGACAAGGCTTCAGGGCCGATAGCAAGCATCGGGCTGATTCGCGCACCTAGCGCTCCGCGACCGCCCTAT
GCCGATCGCGAGATGGCATGGCGTCTGATCCGGCAACTGAACTTCAACTATCTGGCGCTGGAAGATCAGG
ACCATCGGCCGGGCGGGCAGGCGCTGCGCGACTTGCTGCGTCTTTACGTGATGGATGACGACACCGATCA
TCAACGCCAGATCGAGGGGCTGGTTGGCGTGAAAACACGCCCGGTGACGCGCAAGCTCTCCGGCAAGGGA
CCTATGACGTTCGGACGCGGCATCGAATGTGCGTTGACCATCGACGAGACCGGCTTTTCGGGCATCAGCC
CTTATCTGTTCGGGTTGATTCTGGAGCACTGGCTCGCGCGCCATGTGTCGATCAACAGTTTCACGCAGAC
TGAGCTCCATTCCATGCAACGCGGCAAGGTCATGACCTGGCCGGTGCGCACTGGCACGCGTGGAGTAGTT
TGA