SecReT6
Protein ID: 507514873
SecReT6 ID765
T6SS typeN/A
Gene symbol-
Locus tagBRPE64_ACDS03400
StrainBurkholderia sp. RPE64
Repliconchromosome I [GenBank: NC_021287] [Browse all T6SS(s) in this replicon]
Location [Strand]344530..345588 [+]
Producttype VI secretion protein VC_A0111 family
NoteTssG
UniProt IDR4WF79
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.00E-104, Aligned region: 24..324
Protein Sequence: 352 a.a.     [Download]
>gi|507514873|ref|YP_008036490.1| type VI secretion protein VC_A0111 family [Burkholderia sp. RPE64]
MHITLSDLIQDDILSPELIDKLEAEPWRYGFLALLRRIAAHPGVDAIGTARRPRAEPFRLGQQPSLAFAP
REIASVGQADGRLKIKLLSLGMLGPNGPLPIHVTEIARDREQSRNDTTTTDFFDIFHHRAFALFYRAWAS
AQSAAGLDRVDDERFSFYIACLSGQDHNEMRYRALPSHARLAASAHLVRESRNPDGLRSTLAHYFGVPVE
IQEYVFHWIDIEREDQGRMGHAGNGARMGHGAMLGRVAPDRQHRFRIVIGPVDLESYLRFTPKGSDLPHL
VEWVRAFVGKELEWELELRINPDSAPPAQMGGKQQIGWSGWLGRPNLNRPITGMIFEPERYAHQFKRNLR
ND
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|507514533|ref|NC_021287.1|:344530-345588 Burkholderia sp. RPE64 DNA, chromosome 1, complete genome
ATGCACATCACACTATCCGACCTGATTCAAGACGACATTCTGTCGCCCGAGTTGATCGACAAGCTGGAGG
CCGAGCCGTGGCGCTATGGCTTTCTCGCGCTGTTGCGCAGAATCGCCGCGCATCCCGGCGTGGATGCCAT
TGGCACGGCGCGTCGTCCTCGCGCGGAACCGTTTCGGCTCGGCCAGCAACCGAGTCTCGCCTTTGCGCCG
CGCGAGATTGCGAGCGTCGGTCAGGCCGATGGCCGCCTGAAGATCAAGCTGTTGAGTCTCGGCATGCTTG
GCCCGAACGGCCCGTTGCCGATCCATGTCACCGAGATCGCGCGGGATCGTGAACAGAGCCGCAACGACAC
CACGACGACCGATTTCTTTGACATCTTCCATCACCGCGCTTTTGCGCTGTTTTACCGCGCGTGGGCGTCG
GCACAATCGGCGGCGGGACTCGATCGTGTAGACGACGAGCGGTTCTCTTTTTACATCGCCTGTCTGAGCG
GACAGGACCACAATGAGATGCGCTATCGCGCGTTGCCTTCGCACGCGCGACTCGCGGCATCGGCGCATCT
CGTGCGTGAATCGCGTAACCCGGATGGGTTGCGCAGCACGCTGGCGCATTACTTCGGTGTGCCCGTGGAA
ATCCAGGAATACGTTTTTCACTGGATCGACATCGAGCGCGAAGATCAGGGACGCATGGGGCACGCCGGCA
ACGGCGCGAGGATGGGGCACGGCGCAATGCTCGGTCGTGTTGCGCCTGATCGGCAGCACCGTTTTCGTAT
TGTGATCGGGCCGGTCGATCTCGAGTCATATTTGCGCTTCACGCCCAAGGGCTCGGATTTGCCTCATTTG
GTCGAGTGGGTGCGCGCGTTCGTTGGCAAGGAGCTCGAATGGGAACTTGAGTTGCGGATTAATCCCGACA
GCGCGCCACCCGCCCAGATGGGCGGTAAGCAGCAGATCGGCTGGTCTGGCTGGCTCGGTCGGCCCAATCT
GAATAGACCGATCACCGGAATGATCTTCGAACCCGAGCGCTACGCTCATCAATTTAAACGCAACCTTCGG
AACGACTAG