SecReT6
Protein ID: 507514874
SecReT6 ID765
T6SS typeN/A
Gene symbol-
Locus tagBRPE64_ACDS03410
StrainBurkholderia sp. RPE64
Repliconchromosome I [GenBank: NC_021287] [Browse all T6SS(s) in this replicon]
Location [Strand]345677..346771 [+]
ProductImpA domain protein
NoteTssA
UniProt IDR4WMJ5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.80E-22, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 1.80E-22, Aligned region: 210..219
Protein Sequence: 364 a.a.     [Download]
>gi|507514874|ref|YP_008036491.1| ImpA domain protein [Burkholderia sp. RPE64]
MTGAASDWMTPVSAQSPCGPDLEYDHDFVVLFASTVPKQEVQYGSFVGAADPINWAEVERDCRRLMSRTK
DLRVAVLYTRCRTRLGGAKGFAEGTTLLAAWLQSYPDRIHPCAGETYERDEALEMRMNALHGLVDPEGLL
ADAREIVLAKSTAARLQVRDVERAFGYPRPADALAPDSVTQQLRALRIQQPATMQAFDEALANLAAIESW
CAAHMEGYEPDLELLTKLLNPLRSPEVDTSALEMEPSETVELVEEIVDSAPAETEEEVVAVSDEGIAEDI
DASATAAAPVVTYSTVINGRQAALATIRAARKWFESNEPSSPVPVLLRRAEYCVGKRYFEVVKAIPFELL
AEWEAPDEEGAATS
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|507514533|ref|NC_021287.1|:345677-346771 Burkholderia sp. RPE64 DNA, chromosome 1, complete genome
GTGACGGGTGCCGCATCCGACTGGATGACGCCTGTTAGCGCGCAATCCCCGTGCGGTCCCGACCTCGAAT
ACGATCACGACTTCGTCGTGCTGTTTGCCAGCACCGTCCCGAAGCAAGAGGTGCAGTACGGCTCGTTCGT
CGGTGCCGCGGATCCCATCAACTGGGCAGAGGTAGAACGTGACTGCCGCCGGTTGATGAGTCGCACGAAA
GATCTCCGCGTCGCGGTGTTGTACACCCGCTGCCGCACACGTCTCGGTGGTGCTAAAGGCTTTGCGGAAG
GCACGACGCTGCTAGCCGCATGGTTGCAGTCGTATCCCGATCGAATTCATCCATGCGCGGGCGAAACGTA
CGAGCGCGACGAAGCGCTGGAAATGCGTATGAACGCGCTGCATGGACTGGTCGATCCCGAAGGCCTGCTC
GCCGATGCGCGCGAGATCGTGCTGGCGAAATCCACGGCGGCGCGTTTGCAGGTGCGCGACGTGGAGCGGG
CGTTCGGCTATCCGCGTCCGGCCGATGCACTCGCGCCGGACTCAGTGACGCAGCAGTTGCGGGCCCTGCG
CATCCAGCAACCGGCCACGATGCAGGCATTCGATGAAGCGCTGGCGAACCTTGCAGCAATCGAGAGTTGG
TGCGCTGCGCATATGGAAGGTTACGAGCCGGACCTTGAACTACTCACCAAGCTGTTGAACCCGCTGCGCT
CGCCTGAAGTCGATACGTCGGCGTTAGAGATGGAGCCTTCGGAAACCGTGGAGCTGGTCGAAGAGATTGT
GGATAGCGCACCTGCCGAGACGGAGGAGGAAGTGGTTGCGGTTTCCGATGAAGGCATTGCCGAAGATATC
GACGCGTCAGCCACGGCGGCAGCGCCTGTTGTCACGTACAGCACCGTTATAAATGGCCGGCAAGCCGCGC
TGGCTACGATTCGTGCAGCCCGTAAGTGGTTTGAATCGAATGAACCGAGCAGCCCGGTCCCTGTTCTTCT
GAGGCGCGCGGAATACTGCGTGGGCAAGCGTTACTTTGAAGTCGTGAAAGCAATTCCGTTCGAGCTGCTT
GCAGAGTGGGAGGCGCCGGACGAAGAGGGAGCGGCTACGTCATAA