SecReT6
Protein ID: 507517896
SecReT6 ID766
T6SS typei1
Gene symbol-
Locus tagBRPE64_CCDS04550
StrainBurkholderia sp. RPE64
Repliconchromosome III [GenBank: NC_021288] [Browse all T6SS(s) in this replicon]
Location [Strand]456896..459001 [+]
Productsensor histidine kinase
NoteVirA
UniProt IDR4WPD5
KEGG IDbuo:BRPE64_CCDS04550
PDB IDNA
Domain hit(s) vs Pfam HATPase_c [PF02518], Evalue: 1.6e-19, Aligned region: 441..558
MASE1 [PF05231], Evalue: 4.8e-17, Aligned region: 54..316
HisKA [PF00512], Evalue: 8.8e-08, Aligned region: 331..394
Protein Sequence: 701 a.a.     [Download]
>gi|507517896|ref|YP_008039512.1| sensor histidine kinase [Burkholderia sp. RPE64]
MVLRALIAMSHSFRHVFADDAPREASTINRARALAEPVLLGLLCYLLARPVAHLGGAGTLAAIAWPAPAV
AIAMIWPLPPRRWPLHLLAVFVAIAATGDFSATSWRSDLGFCVLDVLEVALCAWLGRRFVDARGNIVTTS
ALMRFLLLLPLAAIGITSMLGATLASDLSHDGWWREWRTLIVGNGVAVLVLTPAVLAWRARSADSAAPAR
YPESCIALACSAAVIALLVAAAALHVSEQVQRVVVSLLLAATAIYGGLAAAATTVGTASVVGVALTLMTF
GPYHVENAESARNLQIDMAGLAILTLFVGVAARERRQLALRLERGRRMEALGLLAGGVAHDFKNILAAVD
GYAEIARDRLAADSAARMPLREVQVASARGYALTEEILLAARRGDRVRETLDLMSVVKESVALARPLCRG
GVVIELEPADARLMVAAHGGQLVRAVLNLASNASLAARSRVVLRVGSARSADEPFAVGDAPPGAIAWVDV
EDDGAGILAEHLPHLFEPFFSTRARSGQRGGGTGLGLAIVAGVACEHRGGVAISTSAAGTRFRLVLPLVS
SAPASSDTADDAADEAQPFAQGERIIVIDTDRDARECCEDWLAETGFEPLGYADADEALDEAASMDDDRP
LLFADLDRLPTDPHAFIARAAACAPRLHLILSSADPALLRAVHAARRAVLSKPFDREALARAAASALKDP
S
 
Nucleotide Sequence: 2106 bp     [Download]
>gi|507517441|ref|NC_021288.1|:456896-459001 Burkholderia sp. RPE64 DNA, chromosome 3, complete genome
ATGGTTCTGCGCGCGCTCATCGCCATGTCTCACTCCTTTCGGCACGTTTTCGCGGACGACGCCCCGCGCG
AAGCAAGCACGATAAACCGCGCCCGCGCGCTGGCCGAGCCGGTCCTGCTTGGCCTGCTCTGTTATCTGCT
GGCGCGGCCCGTCGCGCATCTGGGCGGCGCGGGCACGCTCGCCGCCATCGCGTGGCCGGCGCCCGCCGTC
GCCATCGCGATGATCTGGCCGCTGCCGCCGCGCCGCTGGCCGCTTCATCTGCTCGCGGTGTTCGTCGCGA
TTGCCGCGACGGGCGATTTCAGCGCGACGTCATGGCGCAGCGATCTGGGCTTCTGTGTTCTCGATGTGCT
CGAAGTGGCGCTGTGCGCGTGGCTCGGCCGCCGTTTCGTCGATGCGCGCGGGAACATCGTCACGACTTCC
GCGCTGATGCGCTTCCTGTTGCTGCTGCCGCTCGCGGCCATCGGCATTACGTCGATGCTCGGCGCCACGC
TCGCCAGCGATCTGAGCCATGACGGATGGTGGCGCGAATGGCGCACGTTGATTGTCGGCAACGGCGTCGC
GGTGCTGGTGCTGACGCCCGCCGTGCTCGCATGGCGCGCGCGTTCCGCCGACAGCGCCGCGCCCGCCCGT
TACCCCGAATCGTGCATCGCGCTGGCGTGCAGTGCCGCCGTGATCGCGTTGCTCGTCGCGGCGGCGGCGC
TGCATGTGTCGGAGCAAGTGCAGCGCGTGGTCGTCTCGCTGCTGTTGGCCGCGACCGCGATTTACGGCGG
ACTCGCCGCCGCCGCGACGACGGTCGGCACCGCGTCGGTGGTCGGCGTCGCGCTCACGCTGATGACCTTC
GGCCCGTATCACGTCGAAAACGCCGAGAGCGCGCGCAATCTGCAAATCGACATGGCGGGGCTCGCCATTC
TCACGCTGTTCGTCGGCGTGGCCGCGCGCGAGCGACGGCAACTCGCGCTGCGCCTCGAACGCGGGCGGCG
CATGGAAGCGCTCGGGCTGCTGGCCGGCGGCGTCGCGCACGACTTCAAGAATATTCTCGCCGCCGTCGAT
GGTTATGCCGAAATCGCCCGCGACAGGCTCGCCGCCGATTCCGCCGCGCGCATGCCGCTGCGCGAAGTGC
AAGTTGCGTCGGCGCGCGGCTATGCGCTCACCGAGGAAATCCTGCTGGCCGCGCGGCGCGGCGATCGCGT
GCGCGAAACGCTCGATCTGATGTCGGTCGTGAAAGAGAGCGTCGCCCTCGCGCGGCCGTTGTGCCGTGGC
GGCGTGGTTATCGAACTGGAACCGGCGGATGCGCGCCTGATGGTCGCCGCGCACGGCGGCCAGCTCGTGC
GCGCGGTCCTGAATCTGGCGAGCAATGCGAGTCTCGCCGCGCGTTCGCGCGTGGTGTTGCGCGTGGGCAG
CGCCCGGTCGGCGGACGAGCCGTTCGCCGTGGGTGACGCACCGCCCGGCGCAATCGCGTGGGTCGATGTC
GAAGATGACGGCGCGGGCATTCTCGCCGAGCATCTGCCGCATCTGTTCGAGCCGTTTTTTTCGACGCGCG
CGCGGTCGGGCCAACGCGGCGGCGGCACGGGGCTGGGACTGGCGATCGTGGCGGGCGTCGCGTGCGAGCA
TCGCGGCGGCGTGGCCATTTCGACCAGCGCGGCGGGCACGCGTTTTCGTCTCGTGTTGCCGCTCGTGTCG
AGCGCGCCGGCATCATCGGACACGGCGGACGACGCTGCCGACGAAGCGCAGCCGTTCGCGCAGGGCGAAC
GCATTATCGTGATCGATACCGATCGGGACGCCCGCGAGTGCTGCGAAGACTGGCTCGCGGAAACGGGCTT
CGAGCCGCTCGGTTACGCCGATGCAGACGAAGCCCTCGACGAAGCCGCGAGCATGGACGACGACCGTCCG
TTGCTGTTCGCCGACCTCGACCGCCTGCCGACAGACCCGCACGCGTTTATCGCGCGCGCCGCCGCCTGCG
CGCCGAGGCTGCATCTCATCCTCTCCTCCGCCGATCCGGCCTTGCTGCGCGCCGTGCACGCCGCGCGCCG
CGCCGTGCTGTCCAAACCGTTCGATCGCGAGGCGCTCGCGCGCGCCGCCGCATCCGCCCTGAAGGATCCG
TCATGA