SecReT6
Protein ID: 507517897
SecReT6 ID766
T6SS typei1
Gene symbol-
Locus tagBRPE64_CCDS04560
StrainBurkholderia sp. RPE64
Repliconchromosome III [GenBank: NC_021288] [Browse all T6SS(s) in this replicon]
Location [Strand]458998..459732 [+]
ProductDNA-binding response regulator VirG
NoteVirG
UniProt IDR4WPM8
KEGG IDbuo:BRPE64_CCDS04560
PDB IDNA
Domain hit(s) vs Pfam Response_reg [PF00072], Evalue: 2.90E-26, Aligned region: 9..116
Trans_reg_C [PF00486], Evalue: 2.70E-19, Aligned region: 22..32
Trans_reg_C [PF00486], Evalue: 2.70E-19, Aligned region: 162..235
Protein Sequence: 244 a.a.     [Download]
>gi|507517897|ref|YP_008039513.1| DNA-binding response regulator VirG [Burkholderia sp. RPE64]
MTLPPHQSILVVDDDHSMRTLLVEYLCGHGYKVDGAASAHEAIGVFAAKRYDLVLLDLGLPDGDGTDLAR
RWREEAQVPIMYITGRKDEADLVMGLELGADDYIVKPFSLREVLARMRAVMRRAGGVSSAPLSRGKLPNA
YRFAGWTLNLNTRRLSAADASTVPLTNSEFNLLVTFLSSPGRIITREKLLESTRAFDDIYDRAIDVQILR
LRRKIEPDPKKPTLLRTERGAGYIFDTDIEHLWT
 
Nucleotide Sequence: 735 bp     [Download]
>gi|507517441|ref|NC_021288.1|:458998-459732 Burkholderia sp. RPE64 DNA, chromosome 3, complete genome
ATGACTTTGCCGCCGCATCAAAGCATCCTCGTGGTCGACGACGACCATTCGATGCGCACCCTGCTCGTCG
AATATCTCTGCGGACACGGCTACAAGGTCGATGGCGCCGCGAGTGCGCACGAGGCGATCGGCGTGTTCGC
CGCCAAGCGTTACGATCTCGTGCTGCTCGATCTCGGCCTGCCCGATGGCGACGGCACCGATCTCGCGCGC
CGCTGGCGAGAGGAGGCGCAGGTGCCGATCATGTACATCACGGGCCGCAAGGACGAAGCCGATCTGGTGA
TGGGACTCGAACTGGGCGCGGACGATTACATCGTCAAGCCGTTCTCGCTGCGCGAAGTGCTCGCGCGCAT
GCGTGCCGTAATGCGGCGTGCGGGCGGCGTGTCGAGCGCGCCGCTGTCGCGCGGCAAGCTGCCGAACGCC
TACCGTTTCGCGGGCTGGACGCTCAATCTGAACACGCGACGGCTGAGCGCGGCGGATGCATCGACGGTGC
CGCTCACCAATTCGGAGTTCAATCTGCTGGTCACGTTTCTCAGCTCGCCGGGCCGCATCATCACACGCGA
AAAGCTGCTCGAAAGTACGCGTGCCTTCGATGACATCTATGATCGCGCGATCGACGTGCAAATTCTGCGG
CTGCGGCGCAAGATCGAGCCCGACCCGAAAAAGCCCACGCTCTTGCGCACCGAGCGCGGCGCGGGCTATA
TCTTCGATACCGACATCGAACACTTGTGGACGTGA