SecReT6
Protein ID: 507517898
SecReT6 ID766
T6SS typei1
Gene symbol-
Locus tagBRPE64_CCDS04570
StrainBurkholderia sp. RPE64
Repliconchromosome III [GenBank: NC_021288] [Browse all T6SS(s) in this replicon]
Location [Strand]459789..461384 [+]
Producttype VI secretion-associated protein VC_A0119 family
NoteTssA
UniProt IDR4WYG7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-20, Aligned region: 48..108
Protein Sequence: 531 a.a.     [Download]
>gi|507517898|ref|YP_008039514.1| type VI secretion-associated protein VC_A0119 family [Burkholderia sp. RPE64]
MNDIKSLGTQPISDAQPCGIDVRDDPDFELLQNEIAKLTNPAASGTPDWEQVVRLSSALLAGKGKDILVA
SYLTGALLITRGLAGLNDGAQMLEGLVATHWDQLYPPLARLRARRNAVQWLIDRVRAHAEEHDWSSWPPQ
DAALVDGLRDALAGIDRVLAEKDDDAPSMQPLRALLGTVQVAEPAPVVVAAPEPVAPAASIAPVAPVAAA
ASVTPAPSPSPAPAAFADAALAPLAVDSSDNASRATDEALERLAAIGAWYAQNEPSSALGFRLRRMGAWA
GIERAPAANGTDTPLPGPIPQLQDALRNLQSRAAHADVIAFAETQVAQYPFWLDVHYAAATSLALLGETW
SAARREVCNETAKFVARMDGIERLKFANGVPFANADTVQWLGTLASPGADAGASAAPDPLAAVMSRARAL
AADNDLPAAAQCLQDAIDKSAAVVGRLRLRTALCDLLLEHRPGARLDAFARALVEEIDRYGVTSWDADLS
ADALRAAYAILSRNDQNEAETAALLARIAPLNVAIAVRLIT
 
Nucleotide Sequence: 1596 bp     [Download]
>gi|507517441|ref|NC_021288.1|:459789-461384 Burkholderia sp. RPE64 DNA, chromosome 3, complete genome
GTGAACGACATCAAAAGCCTGGGTACGCAACCCATCAGCGACGCGCAACCGTGCGGCATCGACGTGCGCG
ACGATCCCGATTTCGAGTTGCTGCAAAACGAAATCGCCAAGCTGACCAATCCGGCCGCGAGCGGCACGCC
CGACTGGGAACAGGTCGTGAGACTCTCGTCCGCGCTGCTCGCGGGCAAGGGCAAGGACATTCTCGTCGCG
AGCTATCTGACCGGCGCGTTGTTGATCACGCGCGGTCTCGCCGGTCTGAACGACGGCGCGCAGATGCTCG
AAGGACTCGTCGCGACGCATTGGGACCAGCTTTATCCGCCGCTTGCGCGGCTGCGGGCGCGGCGCAACGC
CGTGCAGTGGCTGATCGATCGCGTGCGCGCGCATGCCGAGGAGCATGACTGGTCGAGCTGGCCGCCGCAG
GACGCCGCGCTCGTCGATGGACTGCGCGACGCGCTCGCGGGCATCGATCGCGTGCTCGCGGAAAAGGACG
ACGACGCGCCGTCGATGCAGCCGCTGCGCGCGCTGCTCGGCACGGTGCAGGTGGCGGAACCGGCGCCGGT
GGTAGTGGCGGCGCCGGAACCTGTTGCGCCTGCTGCATCGATCGCGCCCGTGGCACCGGTCGCGGCGGCG
GCATCGGTAACACCGGCGCCCTCGCCCTCGCCCGCTCCCGCCGCCTTCGCGGACGCGGCACTTGCGCCGC
TCGCCGTCGATTCATCCGATAACGCCAGCCGCGCCACCGACGAGGCGCTGGAGCGGCTCGCGGCCATCGG
CGCCTGGTACGCGCAGAACGAGCCGTCGAGCGCGCTCGGTTTCCGGCTGCGTCGCATGGGCGCGTGGGCG
GGCATCGAGCGCGCGCCGGCCGCCAACGGCACCGATACGCCGCTGCCCGGTCCGATCCCGCAATTGCAGG
ACGCCCTGCGCAATCTGCAATCGCGCGCGGCGCACGCCGATGTGATCGCCTTCGCCGAAACGCAGGTTGC
GCAGTATCCGTTCTGGCTCGATGTCCACTACGCCGCCGCGACGTCGCTCGCGCTGCTGGGCGAAACGTGG
AGCGCCGCGCGCCGCGAAGTCTGCAACGAGACCGCGAAGTTCGTCGCGCGCATGGACGGCATCGAACGAT
TGAAGTTCGCCAACGGCGTGCCGTTCGCCAATGCCGACACCGTTCAGTGGCTGGGCACGCTGGCTTCGCC
CGGCGCGGATGCAGGCGCTTCGGCCGCACCCGATCCGCTCGCCGCGGTGATGTCGCGCGCACGCGCGCTC
GCCGCCGACAACGATCTGCCCGCCGCCGCGCAATGCCTGCAGGACGCCATCGACAAGAGCGCGGCTGTCG
TCGGGCGGCTGCGGCTGCGCACGGCGCTGTGCGATCTGCTGCTCGAACATCGGCCGGGCGCGCGGCTCGA
TGCGTTCGCGCGCGCGCTGGTGGAGGAAATCGACCGTTACGGCGTGACGTCGTGGGACGCGGATCTTTCC
GCCGATGCGCTGCGCGCCGCCTACGCCATCCTCAGCCGCAACGATCAGAACGAGGCGGAAACGGCGGCGC
TGCTGGCGCGCATCGCACCGCTGAATGTTGCCATCGCGGTGCGGCTGATCACCTGA