SecReT6
Protein ID: 507517900
SecReT6 ID766
T6SS typei1
Gene symbol-
Locus tagBRPE64_CCDS04590
StrainBurkholderia sp. RPE64
Repliconchromosome III [GenBank: NC_021288] [Browse all T6SS(s) in this replicon]
Location [Strand]465279..465968 [-]
Producthypothetical protein
NoteTssL
UniProt IDR4X3N5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.00E-34, Aligned region: 2..214
Protein Sequence: 229 a.a.     [Download]
>gi|507517900|ref|YP_008039516.1| putative uncharacterized protein [Burkholderia sp. RPE64]
MTLADHLIPLFAQVRAFSQSPSGDAASLTVTLDAAIAAARLRAHDAGASQADIDEALFAFSAWADELLLT
TRWDGAAQWQRHLLQRRYSNVSNAGVLFYERLAQLTPAQLPVREVFFLCLALGFGGRYAYDRNQKTLTDI
RRSNLAMLLPDAEQLGASARAFLFPDGYNVAGDEAPAQRRTVRTRLATRFSRGKIAAILLPLFLLALLYG
VYHTVVAQSVDLLVAQIHL
 
Nucleotide Sequence: 690 bp     [Download]
>gi|507517441|ref|NC_021288.1|:c465968-465279 Burkholderia sp. RPE64 DNA, chromosome 3, complete genome
ATGACCCTCGCCGATCATCTGATTCCGCTTTTCGCGCAAGTCCGCGCGTTCTCGCAGTCGCCCTCGGGCG
ATGCCGCGAGCCTCACCGTTACGCTCGATGCCGCCATCGCCGCGGCCCGGCTGCGCGCGCACGACGCGGG
CGCGTCGCAGGCCGATATCGACGAGGCGCTGTTCGCCTTCAGCGCCTGGGCCGACGAACTGCTGCTCACC
ACGCGCTGGGACGGCGCGGCGCAATGGCAGCGTCATCTGCTGCAACGCCGTTATTCGAACGTGAGCAATG
CGGGCGTGCTGTTCTACGAGCGCCTCGCGCAACTGACGCCTGCGCAGTTGCCGGTGCGCGAAGTGTTCTT
CCTGTGTCTCGCGCTCGGCTTCGGCGGACGCTATGCGTACGACCGCAATCAGAAGACGCTCACCGACATC
CGCCGCTCCAATCTCGCGATGCTGCTGCCCGACGCCGAGCAACTCGGCGCGTCGGCGCGCGCGTTCCTGT
TTCCCGACGGCTATAACGTCGCCGGCGATGAAGCTCCGGCGCAACGACGCACCGTGCGCACCCGTCTCGC
CACGCGCTTTTCGCGCGGCAAGATCGCGGCCATCCTGTTACCGCTGTTTCTGCTGGCGCTGCTGTACGGC
GTGTATCACACCGTCGTCGCGCAGTCAGTCGACTTGCTTGTGGCGCAGATCCATCTATGA