SecReT6
Protein ID: 507517901
SecReT6 ID766
T6SS typei1
Gene symbol-
Locus tagBRPE64_CCDS04600
StrainBurkholderia sp. RPE64
Repliconchromosome III [GenBank: NC_021288] [Browse all T6SS(s) in this replicon]
Location [Strand]465970..467361 [-]
Producthypothetical protein
NoteTssK
UniProt IDR4WPD7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.60E-88, Aligned region: 19..462
Protein Sequence: 463 a.a.     [Download]
>gi|507517901|ref|YP_008039517.1| putative uncharacterized protein [Burkholderia sp. RPE64]
MDHNKGIYWYQGMFMQPQHFQLASLHEQFRNKPVFETGLPHFWGAGALDIATGAIASQTIEVRSARLIFP
DRTYVEYPGNAVLAPRSFDAASIGEGRALTVYLGVRKFAAEGNNVTLCDSADAAAGVQTRFASLEQAADV
PDLHSNGPAAPVHTLLHVLKIFFEGETANLGQYDLIPIAQLARIGDTVTLSERFIAPGYALSGSDTLLRI
VREIRDDVVGRAHHLQEFKNPRELQKAEFDPGYMTLLLAMRTLSRAAPRLVHLTQTPNVHPWHVYGELRS
LVGELSAFSERFDMLGDAQDGTPGLPPYDHTDLWNCFSRAQALIGFLLGEIAIGPEHLAVLEYRDGMYAG
DLPRAFFDRRNRFYLVLRTDQQPPAHVVDGALHDARLANAADVTRLVAHALPGLELIHLPNAPQGMPRRA
SSNYFRIEQVSELWDAVERDENIALQWPDAPQDLRAEIVVLRR
 
Nucleotide Sequence: 1392 bp     [Download]
>gi|507517441|ref|NC_021288.1|:c467361-465970 Burkholderia sp. RPE64 DNA, chromosome 3, complete genome
ATGGACCATAACAAGGGCATCTACTGGTATCAGGGCATGTTCATGCAGCCCCAGCATTTTCAGCTGGCGT
CGCTGCACGAACAGTTCCGCAACAAGCCTGTCTTCGAGACGGGTTTGCCGCATTTCTGGGGCGCGGGCGC
ACTCGATATCGCGACGGGCGCGATCGCCAGTCAGACCATCGAAGTGCGTTCGGCGCGGCTGATCTTTCCG
GATCGCACCTACGTTGAATATCCGGGCAATGCCGTGCTCGCGCCGCGTTCGTTCGATGCCGCCTCGATCG
GCGAAGGCCGCGCGCTGACCGTCTATCTCGGCGTGCGCAAGTTCGCGGCCGAGGGCAACAACGTGACCCT
GTGCGATTCCGCCGATGCCGCCGCCGGCGTGCAGACGCGCTTCGCGAGTCTCGAACAGGCCGCCGACGTG
CCCGATCTGCACTCGAACGGTCCGGCCGCGCCCGTGCACACGCTCCTGCATGTGCTCAAGATCTTCTTCG
AAGGCGAGACCGCCAACCTCGGCCAGTACGACCTGATTCCGATTGCGCAACTCGCGCGCATCGGCGACAC
CGTGACGCTGTCGGAGCGCTTCATCGCGCCGGGCTACGCGCTGTCGGGATCGGACACGTTGCTGCGTATC
GTGCGCGAGATTCGCGACGATGTAGTCGGCCGCGCGCATCATCTGCAGGAGTTCAAGAATCCGCGCGAGC
TGCAAAAAGCGGAGTTCGATCCCGGCTACATGACGCTGCTGCTCGCCATGCGCACGCTGTCGCGCGCCGC
GCCCCGGCTCGTGCATCTGACGCAGACGCCGAACGTGCATCCGTGGCACGTCTACGGCGAACTGCGCAGT
CTGGTCGGCGAACTGAGCGCGTTCTCGGAGCGTTTCGACATGCTGGGCGACGCGCAGGACGGCACGCCCG
GCCTGCCTCCGTACGATCACACCGATCTCTGGAACTGCTTCTCGCGCGCGCAGGCGCTGATCGGCTTTTT
GCTGGGCGAAATCGCCATCGGGCCGGAGCATCTCGCGGTGCTGGAGTATCGCGACGGCATGTATGCGGGC
GACTTGCCGCGCGCCTTCTTCGACCGGCGCAACCGCTTTTATCTCGTGCTGCGCACGGATCAGCAGCCGC
CCGCGCACGTGGTCGACGGCGCGCTGCACGACGCGCGTCTCGCCAATGCCGCCGATGTCACGCGGCTGGT
CGCGCATGCGCTTCCCGGACTGGAGCTGATTCATTTGCCGAACGCGCCGCAGGGCATGCCGCGACGCGCG
TCGTCGAACTATTTCCGCATCGAGCAAGTGAGCGAGTTGTGGGACGCGGTCGAGCGCGACGAGAATATCG
CGTTGCAATGGCCGGACGCGCCGCAGGATCTGCGCGCGGAAATCGTCGTGCTGCGGAGATAG