SecReT6
Protein ID: 507517902
SecReT6 ID766
T6SS typei1
Gene symbol-
Locus tagBRPE64_CCDS04610
StrainBurkholderia sp. RPE64
Repliconchromosome III [GenBank: NC_021288] [Browse all T6SS(s) in this replicon]
Location [Strand]467380..468153 [-]
Producthypothetical protein
NoteTssJ
UniProt IDR4WPN4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.60E-18, Aligned region: 36..166
Protein Sequence: 257 a.a.     [Download]
>gi|507517902|ref|YP_008039518.1| putative uncharacterized protein [Burkholderia sp. RPE64]
MVGATAESSAARAGARTRLIRQLIGLTCVALGLGLGLGACSSAPPKDPLADVNWSYATDAVVFEIVADPG
LNQYDGQSHTLLLGVYETADAQAFRNLAADPNALAETMATGKVPQTFAQFSRYVVTPGQHSYLILDRAQN
TRSIGLVAGYAQFGVVNAARQFDVPVITQTSGFIFRTHTKLPGPLVVRLNLGAQGILNAAVQPGALDAAT
IARAQQLEGGGKEIRLSGNGDTGAPAGANGVVGTASTQDTPLRKLSN
 
Nucleotide Sequence: 774 bp     [Download]
>gi|507517441|ref|NC_021288.1|:c468153-467380 Burkholderia sp. RPE64 DNA, chromosome 3, complete genome
ATGGTAGGGGCGACAGCAGAGAGCAGTGCCGCGCGGGCAGGCGCGCGCACACGCCTGATTCGGCAACTGA
TCGGACTGACGTGCGTCGCGCTCGGGCTGGGGCTCGGGCTCGGCGCATGCAGCAGCGCGCCGCCGAAAGA
CCCGCTCGCCGACGTCAACTGGAGCTACGCCACCGACGCCGTGGTGTTTGAAATCGTCGCCGATCCGGGT
CTCAACCAGTACGACGGCCAGTCGCACACGCTGCTGCTCGGCGTCTACGAAACCGCGGATGCGCAAGCCT
TCCGCAATCTCGCCGCCGACCCGAACGCACTCGCCGAGACCATGGCGACCGGCAAGGTGCCGCAGACCTT
CGCGCAGTTTTCCCGCTATGTCGTGACGCCCGGTCAACATTCGTATCTGATCCTCGATCGCGCGCAGAAC
ACCCGGTCGATCGGTCTGGTCGCGGGCTACGCGCAGTTCGGCGTGGTCAACGCGGCGCGCCAGTTCGACG
TGCCGGTGATCACGCAAACCTCGGGCTTCATCTTTCGCACGCACACCAAGTTGCCCGGCCCGCTCGTCGT
GCGGCTGAATCTGGGCGCGCAGGGCATTCTGAACGCCGCCGTGCAGCCCGGCGCACTGGATGCCGCGACC
ATCGCGCGCGCGCAGCAACTCGAAGGCGGCGGCAAGGAAATTCGCCTGAGCGGCAATGGCGATACCGGCG
CGCCTGCGGGCGCGAACGGCGTCGTCGGGACCGCCAGCACGCAGGACACGCCCTTACGCAAGCTCAGCAA
CTAG