SecReT6
Protein ID: 507517905
SecReT6 ID766
T6SS typei1
Gene symbol-
Locus tagBRPE64_CCDS04640
StrainBurkholderia sp. RPE64
Repliconchromosome III [GenBank: NC_021288] [Browse all T6SS(s) in this replicon]
Location [Strand]471804..474653 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDR4X3N6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.30E-54, Aligned region: 35..341
Phage_base_V [PF04717], Evalue: 3.10E-16, Aligned region: 389..482
Protein Sequence: 949 a.a.     [Download]
>gi|507517905|ref|YP_008039521.1| Rhs element Vgr protein [Burkholderia sp. RPE64]
MNALSDNVLANRRFDFRSAAHDAGKFAVVEMEGFEAISQPFRFTLTLVSEDPSIDFDAMLRHPATFLIYP
PDGRDSVPYHGVLAEFDQLHRADGYVFYRAVLVPRLWRLSLYRISEVYLDELPIPATLERVLKGSQLTDS
DYSFRLSGDFERNGAYRPRSFVCQYEETHLDFVSRWLENEGMYYYFDHDAGGQLIVVDDRIMHDANAVEV
DYRPDDEMDTGVSGRSVRDFVSRQKPLPKEVILQEFNHRKAAVPLKIVETVSDDGLGQVMLYGENFRGEQ
EGRRYAKLRAQALVCQGRVFSGEATAVGLRSGYFARLAGHYRHDFNDTYLVTEIHHRGTQAGALLAGVKS
PYSDGGANGETSYRNSFRAIPASVQFRPQRTTSKPRVAGTMTAFIDSEGSGQYAELDEFGQYKVQLPFDL
TDKNPNKGSARVRMATPYAGSDHGMHFPLHKGAEVLLSFTDGDPDRPVIVGAVPNSENPSVVEQASAHEN
RISTAGGNMLHMGDSEGKEVMWLHSPFHNSTIGIGSIDPKGGGSIWSSTAGNSETVTLGTTNATSVGGKN
TLTVGTATTLSAAINNNATLGATLAMSAGMSVTWNGVFAGLPNAAAVGAIAGAAAGGATLGTLGATSNNG
GSPVADGVIAGTAGAAAGGLAGGVAGASGAGSWLSPSVQSLTIDDSTSISLNQKQNQRAVDKVTLSGGQL
PMITATVNTVKTGVKIAASTALAAQAALAIASTYKAYQSDGAKAGAWTPDTTGLLTAQYALGGVEALGVY
GFMQYAARSLATTLNTEAAYVSNATLNETGINIGIGPVGVGAKLAMTTADLGATGRVDMTVGPGGSLATL
SMAATGITMTTLEKIGATGSEVSVTGLVSTTVKAPAVTVEAAGDLALKGVATASLSGATVSVRGTGDVAI
NAAGEAVLRGLGPATVSGSTLLLYADSWVACTGKLIQLG
 
Nucleotide Sequence: 2850 bp     [Download]
>gi|507517441|ref|NC_021288.1|:c474653-471804 Burkholderia sp. RPE64 DNA, chromosome 3, complete genome
GTGAATGCACTGTCTGACAACGTACTCGCGAACCGGCGCTTCGATTTCCGATCCGCCGCGCATGATGCCG
GCAAATTCGCCGTCGTCGAGATGGAAGGCTTCGAGGCGATCTCGCAGCCGTTCCGGTTCACGCTGACCCT
CGTGTCCGAGGATCCGTCGATCGATTTCGACGCCATGCTCAGGCATCCGGCCACATTCCTGATCTATCCG
CCCGACGGCCGGGACAGCGTGCCGTATCACGGCGTGCTGGCCGAGTTCGACCAGTTGCATCGCGCGGACG
GCTACGTGTTTTATCGCGCGGTGCTGGTGCCGCGTCTGTGGCGGCTGTCGCTGTACCGCATCTCCGAGGT
CTATCTCGACGAGCTGCCGATTCCCGCCACGCTCGAACGCGTGCTGAAGGGCAGCCAGCTCACGGACAGC
GACTACTCCTTCAGACTGAGCGGCGATTTCGAGCGCAACGGCGCTTACCGGCCGCGCAGCTTCGTCTGCC
AGTACGAGGAAACGCACCTCGATTTCGTGTCGCGCTGGCTCGAAAACGAGGGCATGTATTACTACTTCGA
TCACGACGCGGGCGGCCAGTTGATCGTGGTCGACGACCGCATCATGCACGACGCGAACGCGGTGGAGGTC
GACTACCGTCCCGACGACGAGATGGACACCGGCGTCTCCGGCCGCTCCGTGCGCGATTTCGTGAGCCGCC
AGAAGCCGTTGCCCAAAGAAGTGATCCTGCAGGAGTTCAATCATCGCAAGGCGGCGGTGCCGCTCAAGAT
TGTCGAAACCGTATCGGACGATGGTCTGGGCCAGGTCATGCTGTACGGCGAAAATTTCCGCGGCGAGCAG
GAAGGCCGGCGGTACGCGAAGCTGCGCGCTCAGGCGCTCGTCTGCCAGGGCCGCGTGTTTTCGGGCGAGG
CCACGGCGGTCGGTCTGCGCAGCGGCTACTTCGCGCGGCTCGCGGGGCATTACCGTCACGATTTCAACGA
CACGTATCTGGTCACCGAGATTCATCATCGCGGCACGCAAGCGGGCGCGCTGCTCGCCGGCGTCAAGAGC
CCGTACAGCGACGGCGGCGCGAACGGCGAGACGTCGTATCGCAACAGCTTCCGCGCGATTCCCGCGAGCG
TGCAGTTCCGGCCGCAGCGCACGACGTCCAAGCCGCGCGTGGCCGGCACCATGACCGCGTTCATCGACAG
CGAAGGCTCGGGCCAGTACGCGGAGCTCGACGAATTCGGCCAGTACAAGGTGCAATTGCCGTTCGATCTG
ACCGACAAGAATCCGAACAAGGGTTCCGCGCGCGTGCGCATGGCGACGCCCTATGCGGGCAGCGACCACG
GCATGCATTTTCCGCTGCACAAGGGGGCCGAGGTGCTGCTGTCGTTCACCGACGGCGATCCGGACCGGCC
CGTGATCGTCGGCGCGGTGCCGAATTCGGAGAATCCGAGCGTCGTCGAACAGGCGAGCGCGCACGAGAAC
CGCATCAGCACGGCGGGCGGCAACATGCTGCACATGGGCGACAGCGAGGGCAAGGAGGTCATGTGGCTGC
ATTCGCCGTTCCATAACAGCACGATCGGCATAGGCTCGATCGATCCGAAGGGCGGCGGCAGCATCTGGAG
CAGCACGGCGGGCAACAGCGAGACCGTGACGCTCGGCACCACCAACGCGACCAGCGTGGGCGGCAAGAAC
ACGCTGACGGTCGGCACCGCGACCACGCTGTCGGCGGCCATCAACAACAACGCGACGCTCGGCGCGACGC
TGGCGATGTCGGCGGGCATGAGCGTGACGTGGAACGGCGTGTTTGCCGGTCTTCCCAACGCCGCGGCGGT
GGGCGCGATCGCGGGGGCGGCGGCGGGCGGCGCGACGCTCGGGACGCTCGGCGCGACCTCGAACAACGGC
GGCTCTCCTGTCGCGGACGGTGTCATCGCCGGCACGGCCGGCGCCGCCGCCGGTGGCCTCGCCGGGGGCG
TGGCGGGCGCATCCGGCGCGGGCAGCTGGCTGTCGCCTTCGGTGCAGTCCCTGACCATCGACGACTCGAC
GAGCATCTCGCTGAACCAGAAGCAGAACCAGCGCGCGGTGGACAAGGTCACGCTCTCCGGCGGTCAGTTG
CCGATGATCACGGCGACGGTGAACACGGTCAAGACGGGCGTCAAGATCGCGGCCAGCACCGCGTTGGCCG
CGCAGGCGGCGCTCGCGATCGCCTCGACTTACAAGGCCTATCAGAGCGACGGCGCGAAGGCCGGCGCCTG
GACGCCCGACACGACCGGGCTGCTGACGGCGCAATACGCGCTCGGCGGCGTCGAGGCGCTCGGCGTGTAC
GGCTTCATGCAGTATGCGGCGCGCTCGCTCGCCACGACCCTGAACACGGAGGCCGCCTACGTGAGCAACG
CCACGCTCAACGAAACCGGCATCAATATCGGCATCGGTCCGGTGGGCGTGGGCGCGAAGCTCGCCATGAC
GACAGCCGATCTCGGCGCGACCGGCCGCGTCGACATGACCGTGGGTCCGGGGGGCTCGCTCGCGACACTC
TCGATGGCCGCCACGGGCATCACGATGACCACGCTCGAGAAAATCGGCGCGACGGGCAGCGAGGTATCGG
TCACGGGGCTCGTTTCGACCACGGTCAAGGCCCCGGCGGTGACGGTGGAAGCGGCAGGCGATCTGGCGCT
CAAGGGTGTCGCGACAGCCAGCCTGAGCGGCGCCACCGTTTCGGTGCGCGGTACGGGCGATGTCGCGATC
AACGCAGCGGGCGAGGCGGTTTTGCGGGGCCTGGGACCCGCCACCGTGAGTGGCTCCACGTTACTGTTGT
ACGCCGACTCGTGGGTCGCCTGCACCGGCAAACTGATCCAGCTGGGCTGA