SecReT6
Protein ID: 507517906
SecReT6 ID766
T6SS typei1
Gene symbol-
Locus tagBRPE64_CCDS04650
StrainBurkholderia sp. RPE64
Repliconchromosome III [GenBank: NC_021288] [Browse all T6SS(s) in this replicon]
Location [Strand]474704..475099 [-]
Producthypothetical protein
NotePAAR
UniProt IDR4WPE0
KEGG IDbuo:BRPE64_CCDS04650
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 1.00E-35, Aligned region: 9..117
PAAR_motif [PF05488], Evalue: 0.00056, Aligned region: 45..56
PAAR_motif [PF05488], Evalue: 0.00056, Aligned region: 57..122
Protein Sequence: 131 a.a.     [Download]
>gi|507517906|ref|YP_008039522.1| putative uncharacterized protein [Burkholderia sp. RPE64]
MFAVTKQAGQCMGAPDVCKTPAPPAPPVPIPYPNIGMPMLGNPATTKVMISGMPALTTASQISMSDGDQA
GVAGGIVSNQVMGPVAFPLGSVCVMLEGAPAVRLGDMTQHNEGNIVGAVVAPSQAVVMVMS
 
Nucleotide Sequence: 396 bp     [Download]
>gi|507517441|ref|NC_021288.1|:c475099-474704 Burkholderia sp. RPE64 DNA, chromosome 3, complete genome
ATGTTCGCAGTCACGAAACAAGCCGGGCAGTGCATGGGCGCGCCCGATGTCTGCAAAACGCCGGCTCCAC
CCGCACCGCCCGTGCCGATCCCGTACCCGAATATCGGCATGCCGATGCTCGGCAATCCCGCCACCACGAA
GGTGATGATCAGCGGCATGCCGGCGTTGACGACCGCTTCGCAAATCTCCATGAGCGACGGCGATCAGGCC
GGCGTGGCGGGCGGCATCGTATCGAACCAGGTGATGGGGCCGGTCGCGTTTCCGCTCGGCAGCGTGTGCG
TGATGCTCGAAGGCGCGCCGGCGGTGCGGCTCGGCGACATGACGCAGCACAACGAAGGAAATATCGTCGG
CGCGGTGGTCGCGCCCAGTCAGGCGGTCGTCATGGTCATGAGCTAG