SecReT6
Protein ID: 507517909
SecReT6 ID766
T6SS typei1
Gene symbol-
Locus tagBRPE64_CCDS04680
StrainBurkholderia sp. RPE64
Repliconchromosome III [GenBank: NC_021288] [Browse all T6SS(s) in this replicon]
Location [Strand]477014..479653 [-]
Producttype VI secretion ATPase ClpV1 family
NoteTssH
UniProt IDR4X269
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.70E-41, Aligned region: 225..269
AAA_2 [PF07724], Evalue: 4.70E-41, Aligned region: 611..776
AAA [PF00004], Evalue: 8.50E-19, Aligned region: 226..336
AAA [PF00004], Evalue: 8.50E-19, Aligned region: 616..737
AAA_16 [PF13191], Evalue: 5.50E-15, Aligned region: 202..241
AAA_16 [PF13191], Evalue: 5.50E-15, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 5.50E-15, Aligned region: 465..502
AAA_16 [PF13191], Evalue: 5.50E-15, Aligned region: 586..651
AAA_16 [PF13191], Evalue: 5.50E-15, Aligned region: 681..703
ClpB_D2-small [PF10431], Evalue: 3.20E-14, Aligned region: 782..853
AAA_5 [PF07728], Evalue: 2.90E-11, Aligned region: 227..242
AAA_5 [PF07728], Evalue: 2.90E-11, Aligned region: 323..355
AAA_5 [PF07728], Evalue: 2.90E-11, Aligned region: 615..731
AAA_22 [PF13401], Evalue: 2.00E-07, Aligned region: 224..311
AAA_22 [PF13401], Evalue: 2.00E-07, Aligned region: 342..385
AAA_22 [PF13401], Evalue: 2.00E-07, Aligned region: 489..530
AAA_22 [PF13401], Evalue: 2.00E-07, Aligned region: 614..634
AAA_22 [PF13401], Evalue: 2.00E-07, Aligned region: 677..709
Clp_N [PF02861], Evalue: 1.00E-05, Aligned region: 27..74
Clp_N [PF02861], Evalue: 1.00E-05, Aligned region: 483..500
AAA_19 [PF13245], Evalue: 1.40E-05, Aligned region: 220..246
AAA_19 [PF13245], Evalue: 1.40E-05, Aligned region: 613..636
Sigma54_activat [PF00158], Evalue: 0.00035, Aligned region: 222..240
Sigma54_activat [PF00158], Evalue: 0.00035, Aligned region: 588..737
AAA_14 [PF13173], Evalue: 0.00037, Aligned region: 231..328
AAA_14 [PF13173], Evalue: 0.00037, Aligned region: 614..696
AAA_14 [PF13173], Evalue: 0.00037, Aligned region: 830..857
Arch_ATPase [PF01637], Evalue: 0.00063, Aligned region: 203..239
Arch_ATPase [PF01637], Evalue: 0.00063, Aligned region: 277..368
Arch_ATPase [PF01637], Evalue: 0.00063, Aligned region: 611..636
Arch_ATPase [PF01637], Evalue: 0.00063, Aligned region: 686..698
AAA_25 [PF13481], Evalue: 0.00079, Aligned region: 225..256
AAA_25 [PF13481], Evalue: 0.00079, Aligned region: 437..506
AAA_25 [PF13481], Evalue: 0.00079, Aligned region: 611..633
IstB_IS21 [PF01695], Evalue: 0.00091, Aligned region: 219..247
IstB_IS21 [PF01695], Evalue: 0.00091, Aligned region: 615..642
Zeta_toxin [PF06414], Evalue: 0.0012, Aligned region: 225..242
Zeta_toxin [PF06414], Evalue: 0.0012, Aligned region: 605..656
RuvB_N [PF05496], Evalue: 0.0032, Aligned region: 225..239
RuvB_N [PF05496], Evalue: 0.0032, Aligned region: 281..305
RuvB_N [PF05496], Evalue: 0.0032, Aligned region: 579..642
AAA_17 [PF13207], Evalue: 0.0034, Aligned region: 228..277
AAA_17 [PF13207], Evalue: 0.0034, Aligned region: 615..649
Protein Sequence: 879 a.a.     [Download]
>gi|507517909|ref|YP_008039525.1| type VI secretion ATPase ClpV1 family [Burkholderia sp. RPE64]
MLLVELKPLVGRLNGFCKQALEDGVGLCVSRGHYEITVEHVLVKLFDEQQADIALLLRQHDVDAALVRRA
INLSLEQMKTGNAGRPAFSPLLLEMLQDAWLIASVDLQEPRIRSGAVLLAFLARPTYYATGDYAAPLRAL
NRETLMRSFDAVCGASVEAGTRDTLGESTGDASAPANGDGSAIARFCENFTEKARAGKLDPVFGRDAEIR
QMVDILARRRKNNPICVGDPGVGKTAVVEGLALRVVEGDVPDSLRDVTIIGLDMGLLQAGASVKGEFENR
LKGVITEVKASAKPIILFIDEAHTLIGAGGQAGTSDAANLLKPALARGELRTIAATTWAEYKKYFEKDAA
LARRFQLVKLDEPDVATATLILRGLKEKYEDVHKVVLRDDAIVAAAELSSRYIMGRQLPDKAVDLLDTAC
ARVKVLQSAKPDVLENTERRMQALQREKNGLQRDADNQQPVDLERLGAIDGELATLTTQADSLRAVWEQQ
REAARALLDARAARHEAKASGASDDTLQTLAHNITSASEAFKAAQGTQPLVHIDVDPDVVARVISDWTGI
PVGKMLRDQAQSVMRMADTLKERIRGQDHAMEQIAEVLKTAKSGLKDPEQPMGVFLLAGPSGVGKTETAL
SVADILFGDEKSTTVINMSEFQEKHNVSRLIGSPPGYVGYGEGGVLTEAVRQRPYSVVLLDEVEKAHLDV
MNLFYQVFDKGMLSDGEGKEIDFSNTVIFLTSNLATDVITEMTAGEDKPDAATLLSAVRPILSNHFKPAL
LARMTVIPYFALATDALAGIVRLKLDKIVRRIAHNNKMRFTYSDAVVAQIAARCTEVETGARNIDFILRG
TILPMMSQEILTRMGGETPLSGVELDVDESGEFVVRIVD
 
Nucleotide Sequence: 2640 bp     [Download]
>gi|507517441|ref|NC_021288.1|:c479653-477014 Burkholderia sp. RPE64 DNA, chromosome 3, complete genome
ATGCTGCTGGTCGAACTGAAGCCCCTCGTGGGCCGCCTCAACGGCTTCTGCAAACAGGCGCTGGAAGACG
GCGTCGGGTTGTGCGTGTCGCGCGGACATTACGAAATCACGGTCGAGCATGTGCTCGTCAAACTGTTCGA
CGAGCAGCAGGCCGATATCGCGCTGCTGTTGCGTCAGCACGATGTCGACGCGGCGCTCGTGCGGCGCGCA
ATCAATCTCTCGCTGGAACAGATGAAGACCGGCAACGCGGGACGTCCCGCGTTCTCGCCGCTGCTGCTCG
AAATGTTGCAGGACGCGTGGCTGATTGCATCGGTGGATCTGCAGGAGCCGCGTATCCGTTCGGGCGCGGT
GCTGCTCGCGTTCCTCGCGCGTCCGACCTACTACGCCACCGGCGACTATGCCGCGCCGCTGCGCGCGTTG
AATCGTGAAACGCTGATGCGTTCGTTCGATGCCGTCTGCGGCGCCTCCGTCGAGGCAGGCACGCGCGACA
CGCTCGGCGAGAGCACGGGCGATGCGTCCGCGCCCGCGAACGGCGACGGCAGCGCAATTGCACGCTTCTG
CGAAAACTTCACGGAGAAGGCGCGCGCCGGCAAGCTCGATCCGGTGTTCGGCCGCGATGCCGAGATTCGC
CAGATGGTCGATATCCTCGCGCGCCGCCGCAAGAACAACCCGATCTGCGTCGGCGATCCCGGTGTCGGCA
AGACGGCGGTGGTCGAAGGACTGGCGCTGCGCGTGGTGGAGGGCGACGTGCCCGATTCGCTCAGGGACGT
GACCATCATCGGTCTCGATATGGGCCTGTTGCAGGCGGGCGCGAGCGTGAAGGGCGAGTTCGAGAATCGC
CTCAAGGGCGTGATCACGGAAGTGAAGGCATCGGCGAAACCGATCATTCTGTTCATCGACGAAGCGCATA
CGCTGATCGGCGCAGGCGGTCAGGCGGGCACGTCGGACGCGGCCAATCTGCTCAAGCCCGCACTCGCGCG
CGGCGAGTTGCGCACCATCGCCGCGACGACGTGGGCCGAATACAAGAAGTACTTCGAAAAAGACGCGGCT
CTTGCGCGCCGCTTCCAGCTCGTCAAGCTCGACGAGCCGGATGTCGCGACCGCAACGCTGATCCTGCGCG
GCCTGAAAGAGAAGTACGAGGACGTGCACAAGGTCGTGCTGCGCGATGACGCTATCGTCGCGGCGGCCGA
ATTGTCGAGCCGCTACATCATGGGCCGTCAGCTGCCGGACAAGGCGGTCGATCTGCTCGACACCGCCTGC
GCGCGCGTGAAGGTGCTGCAAAGCGCGAAGCCGGACGTGCTGGAAAATACCGAACGCCGCATGCAGGCTT
TGCAGCGCGAGAAGAACGGCCTGCAACGCGATGCCGATAATCAGCAGCCCGTGGACCTCGAACGTCTCGG
CGCGATCGATGGCGAACTCGCGACGCTCACCACGCAGGCCGACTCGCTGCGCGCGGTGTGGGAGCAGCAG
CGCGAAGCCGCGCGCGCCTTGCTCGATGCACGCGCCGCCCGCCATGAAGCCAAGGCGTCGGGCGCCTCGG
ACGATACCTTGCAGACGCTCGCGCACAACATCACCTCGGCGAGCGAAGCCTTCAAGGCCGCGCAGGGCAC
GCAGCCGCTCGTGCATATCGACGTCGATCCGGATGTGGTCGCGCGCGTGATCTCGGACTGGACCGGCATT
CCGGTCGGCAAGATGCTGCGCGATCAGGCGCAGAGCGTGATGCGCATGGCCGACACGCTGAAGGAGCGCA
TTCGCGGCCAGGACCACGCGATGGAGCAGATCGCCGAAGTGCTGAAGACCGCCAAGTCGGGCCTGAAAGA
CCCTGAGCAGCCGATGGGCGTGTTCCTGCTCGCGGGACCGTCGGGCGTCGGCAAGACGGAGACGGCGCTG
TCGGTCGCGGACATCCTGTTCGGCGACGAGAAATCGACCACCGTCATCAACATGAGCGAGTTCCAGGAGA
AGCACAACGTCAGCCGGCTGATCGGCTCGCCGCCGGGCTATGTCGGCTATGGCGAAGGCGGCGTGCTGAC
CGAGGCGGTGCGGCAGCGTCCGTACTCCGTCGTGCTGCTCGACGAAGTCGAGAAGGCGCACCTCGACGTG
ATGAACCTGTTCTATCAGGTGTTCGACAAGGGCATGCTCTCGGACGGCGAGGGCAAGGAGATCGACTTCT
CGAACACGGTGATCTTCCTCACGTCGAATCTCGCGACCGATGTCATCACCGAAATGACGGCGGGCGAAGA
CAAGCCGGATGCCGCAACCCTGCTCTCCGCAGTGCGCCCGATTCTCTCGAACCACTTCAAGCCCGCGTTG
CTCGCGCGCATGACGGTGATTCCGTATTTCGCGCTCGCGACCGATGCGCTGGCCGGCATCGTGCGCCTCA
AGCTCGACAAGATCGTGCGCCGCATCGCGCACAACAACAAGATGCGCTTCACCTACAGCGACGCAGTCGT
CGCGCAGATCGCCGCGCGCTGCACCGAGGTCGAGACGGGCGCGCGCAACATCGACTTCATTCTGCGCGGC
ACGATCTTGCCGATGATGTCGCAGGAAATTCTCACGCGCATGGGCGGCGAGACGCCGCTTTCGGGCGTCG
AACTCGATGTCGATGAAAGCGGGGAATTCGTCGTGCGCATCGTCGACTGA