SecReT6
Protein ID: 507517910
SecReT6 ID766
T6SS typei1
Gene symbol-
Locus tagBRPE64_CCDS04690
StrainBurkholderia sp. RPE64
Repliconchromosome III [GenBank: NC_021288] [Browse all T6SS(s) in this replicon]
Location [Strand]479698..480681 [-]
Producthypothetical protein
NoteTssG
UniProt IDR4X3N8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.70E-76, Aligned region: 20..313
Protein Sequence: 327 a.a.     [Download]
>gi|507517910|ref|YP_008039526.1| putative uncharacterized protein [Burkholderia sp. RPE64]
MASETRATSDAVKALLLTNGEKYSYFQAIRLLRLYDRHTGLNQENLRVRPRLGLGFPENDIDRIEAMPAG
GYRITANFFGLYGVASPLPTYYTEDLFEEERDGHHVTRDFLDIVHHALYPLLFDAWAKYRVEQRIVEDRH
EASLNQLYAFVGLHDADLRADLLPGSAELLRYAGLFNQRPHSALGLKTLLADAFAPAQVEVVCGVMRAVP
IPGDQRWQLGLGQSRLGEDAWLGSEIDDYQSTIRLEFADVPQALFHQMLPGGSAHARLRFFTRFYLTDPL
DVEVALQLRHDEAGAARTGRGAWSRLGFDTWLNPGEAALPTRVQYAL
 
Nucleotide Sequence: 984 bp     [Download]
>gi|507517441|ref|NC_021288.1|:c480681-479698 Burkholderia sp. RPE64 DNA, chromosome 3, complete genome
ATGGCCTCCGAGACTCGGGCAACAAGCGATGCTGTAAAGGCGCTGCTGCTCACCAACGGTGAGAAGTATT
CGTACTTTCAGGCCATCCGCTTGCTGCGTCTTTACGACCGGCACACGGGCCTGAATCAGGAGAATCTGCG
CGTTCGTCCGCGGCTCGGGTTGGGCTTTCCCGAGAACGATATCGACCGCATCGAGGCGATGCCCGCGGGC
GGCTATCGCATCACGGCGAACTTTTTCGGCCTGTACGGCGTGGCCTCGCCGCTGCCGACGTATTACACCG
AAGACCTGTTCGAAGAGGAGCGCGACGGCCATCACGTCACGCGCGATTTCCTCGACATCGTTCATCACGC
GCTGTATCCGCTGCTGTTCGACGCATGGGCGAAGTATCGGGTCGAACAGCGCATCGTCGAGGACCGGCAC
GAGGCATCGCTCAATCAGCTGTATGCGTTCGTCGGCCTGCACGATGCCGACCTGCGCGCCGACCTTCTGC
CGGGCAGCGCCGAACTGCTGCGTTATGCGGGGCTTTTCAATCAGCGTCCGCATTCGGCGCTCGGCCTCAA
GACCTTGCTCGCCGACGCCTTCGCGCCCGCGCAGGTCGAGGTCGTGTGCGGCGTGATGCGCGCGGTGCCG
ATTCCCGGCGATCAACGTTGGCAACTCGGCCTCGGGCAGAGCCGGCTCGGCGAAGACGCATGGCTCGGCA
GCGAGATCGACGATTACCAGAGCACCATCCGGCTCGAATTCGCCGATGTGCCGCAAGCCCTGTTTCATCA
GATGCTGCCGGGCGGAAGCGCCCATGCGCGTCTGCGTTTCTTCACGCGTTTCTATCTGACCGATCCGCTG
GATGTCGAAGTGGCACTGCAACTGCGTCACGACGAAGCCGGCGCGGCGCGCACGGGTCGCGGCGCGTGGT
CGCGTCTTGGCTTCGACACCTGGCTCAATCCCGGCGAAGCGGCATTGCCGACGCGGGTTCAATACGCTCT
CTAA