SecReT6
Protein ID: 507517911
SecReT6 ID766
T6SS typei1
Gene symbol-
Locus tagBRPE64_CCDS04700
StrainBurkholderia sp. RPE64
Repliconchromosome III [GenBank: NC_021288] [Browse all T6SS(s) in this replicon]
Location [Strand]480645..482369 [-]
Producthypothetical protein
NoteTssF
UniProt IDR4WPE7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.10E-166, Aligned region: 2..574
Protein Sequence: 574 a.a.     [Download]
>gi|507517911|ref|YP_008039527.1| putative uncharacterized protein [Burkholderia sp. RPE64]
MFNRYYQDELNKLKGLAGEFARANPAIAPMLSGTSADPDVERLLEGVAFLTGLTRQKLDDEFPEFIQELT
HLLFPHYLRPVPASTLISFATKGPRAQLARVAAGTELASVPVDGTTCRFRTTCDLDVEPLRIAEVNLLSH
AGAAPVLMIEFEMDGGLNIAQWNGDSIRLFLNGGYVDAAKLLLLLMNHVTDVRISSGGGERLSLGAKHIR
TSGFDADLLAYPNHALPGYRTIQEFFAMPEKFLFVDIVGLKRWTANAKGTSFSIVMTLDALPEWMPAIDA
QSFLLNVVPAINVFAHVADPITHEHRATEYRVNPEGRDRRHFQIYSVDQVLGYQQGQARERVYQPFSMFR
HDGRGAQLSYRTTLKNANVERGSDVYLSLNYPPSETPLAETLSIRVTCTNRSLPEGLKPGDINVPTSTSP
DQMSFTNIRAITPAQDPPAGEELLWCLLSHVSLNLLSLASAENLRKLLGLYVFAGRQGPDMSNRRRIEGI
VDMTATRETRLVGRGGMQRGQLIRIRCREDHYAGIGDLYLFGCMLERFLGDYAGINSYTRVELEDTLSGT
VFKWPPRLGQQAML
 
Nucleotide Sequence: 1725 bp     [Download]
>gi|507517441|ref|NC_021288.1|:c482369-480645 Burkholderia sp. RPE64 DNA, chromosome 3, complete genome
ATGTTCAATCGATACTATCAGGATGAGCTGAACAAGCTGAAAGGCCTGGCCGGCGAGTTCGCACGCGCGA
ACCCGGCCATTGCCCCGATGCTCTCGGGCACGTCCGCCGATCCGGATGTCGAGCGTCTGCTCGAAGGCGT
CGCGTTTCTCACGGGCCTGACGCGTCAGAAGCTCGACGACGAATTCCCCGAGTTCATTCAGGAACTCACG
CATCTGCTGTTTCCGCACTATCTGCGTCCGGTGCCCGCATCGACGCTGATCAGCTTCGCAACGAAAGGCC
CGCGCGCGCAACTGGCGCGTGTTGCAGCGGGCACCGAACTCGCGTCCGTGCCGGTGGACGGCACGACATG
CCGCTTTCGCACCACCTGCGATCTCGATGTCGAACCGCTGCGGATCGCCGAAGTCAATCTGCTGAGCCAT
GCGGGCGCCGCCCCCGTGCTGATGATCGAGTTCGAGATGGACGGCGGCCTGAACATCGCGCAATGGAACG
GCGATTCCATTCGCCTGTTTCTGAACGGCGGCTATGTCGATGCCGCGAAACTGCTGCTGCTGTTGATGAA
CCATGTCACGGACGTGCGCATTTCGAGCGGCGGCGGCGAGCGGCTTTCGCTCGGCGCGAAGCATATCCGC
ACCAGCGGTTTCGATGCCGATCTGCTCGCTTATCCGAACCATGCGCTGCCCGGCTATCGCACCATTCAGG
AATTTTTCGCGATGCCGGAGAAGTTTCTCTTCGTCGATATCGTTGGCCTGAAGCGCTGGACGGCGAACGC
GAAGGGCACGAGTTTCAGCATCGTGATGACGCTCGACGCGCTGCCCGAGTGGATGCCCGCAATCGACGCG
CAGAGCTTCCTGCTCAACGTCGTGCCGGCGATCAACGTGTTCGCGCATGTCGCCGATCCGATCACGCACG
AGCATCGCGCAACGGAATATCGTGTGAATCCCGAAGGCCGCGACCGCCGGCATTTCCAGATCTATTCCGT
CGATCAGGTGCTGGGCTATCAGCAAGGTCAGGCGCGCGAACGCGTGTATCAGCCGTTCAGCATGTTTCGT
CACGACGGACGCGGCGCGCAACTGAGCTATCGCACCACGCTCAAGAATGCGAATGTCGAGCGCGGCAGCG
ACGTGTATCTGTCGCTGAACTATCCGCCTTCGGAGACGCCGCTTGCGGAGACGTTGTCGATTCGCGTCAC
CTGTACGAATCGTTCGTTACCGGAAGGACTCAAGCCGGGCGATATCAACGTGCCGACCAGCACGTCGCCC
GATCAGATGAGCTTCACCAATATCCGCGCGATCACGCCCGCGCAGGACCCGCCCGCAGGCGAGGAACTGC
TGTGGTGCCTGCTCTCGCATGTGTCGCTGAATCTGCTGTCGCTGGCGAGCGCCGAGAATCTGCGCAAGCT
GCTCGGCCTGTATGTGTTCGCGGGCAGGCAGGGGCCGGACATGTCGAACCGGCGCCGTATCGAAGGCATC
GTCGATATGACGGCCACGCGCGAAACGCGCCTCGTGGGACGCGGCGGCATGCAGCGCGGCCAGTTGATCC
GTATTCGTTGTCGTGAGGACCATTACGCCGGGATCGGCGATCTGTATCTCTTCGGCTGCATGCTCGAGCG
ATTTCTCGGCGATTACGCCGGCATCAATTCCTATACGCGCGTCGAGCTCGAAGACACGCTTTCAGGCACC
GTATTCAAATGGCCTCCGAGACTCGGGCAACAAGCGATGCTGTAA