SecReT6
Protein ID: 507517912
SecReT6 ID766
T6SS typei1
Gene symbol-
Locus tagBRPE64_CCDS04710
StrainBurkholderia sp. RPE64
Repliconchromosome III [GenBank: NC_021288] [Browse all T6SS(s) in this replicon]
Location [Strand]482420..482818 [-]
Producthypothetical protein
NoteTssE
UniProt IDR4WPP5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.50E-18, Aligned region: 21..113
Protein Sequence: 132 a.a.     [Download]
>gi|507517912|ref|YP_008039528.1| putative uncharacterized protein [Burkholderia sp. RPE64]
MLERIASWGAQERRTNETQVDVLVHSVMSHLSRLLNTRQGSVQIDPLFGVPDFTNLAGTTAMGSTREIEE
EIRRMVLRYEPRIKSPRVTLNREKTDVLAIRFALEGALEVDDREIPLRISTTVGANGRVSVD
 
Nucleotide Sequence: 399 bp     [Download]
>gi|507517441|ref|NC_021288.1|:c482818-482420 Burkholderia sp. RPE64 DNA, chromosome 3, complete genome
TTGCTGGAACGAATCGCGAGTTGGGGTGCGCAAGAACGCCGCACCAACGAGACGCAGGTGGATGTGCTCG
TTCACTCGGTGATGAGTCACCTGAGCCGGTTGCTCAATACACGGCAGGGCAGCGTGCAGATCGATCCGCT
TTTCGGCGTGCCCGATTTCACCAACCTGGCCGGCACCACCGCGATGGGTTCCACGCGAGAGATCGAAGAA
GAGATTCGCCGCATGGTCCTGCGTTACGAACCCCGCATCAAGTCGCCGCGCGTCACGCTCAATCGCGAGA
AGACGGACGTGCTGGCGATCCGCTTCGCGCTCGAAGGCGCGCTCGAAGTGGATGACCGCGAAATTCCCCT
GCGTATTTCGACGACCGTAGGCGCCAACGGCCGCGTCAGCGTCGACTGA