SecReT6
Protein ID: 507517913
SecReT6 ID766
T6SS typei1
Gene symbol-
Locus tagBRPE64_CCDS04720
StrainBurkholderia sp. RPE64
Repliconchromosome III [GenBank: NC_021288] [Browse all T6SS(s) in this replicon]
Location [Strand]482857..483345 [-]
Producthcp protein
NoteTssD
UniProt IDR4WYH7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.60E-41, Aligned region: 6..146
Protein Sequence: 162 a.a.     [Download]
>gi|507517913|ref|YP_008039529.1| hcp protein [Burkholderia sp. RPE64]
MPMPCYLTLEGQNQGKIEGSTKVQGHEGKILVQAVDHTIEIPKSPQTGLPTGKRVHLPMTLTKEIDKSSP
KLFQALTSGEQMKDVTLEFYRISPKGTEEKYYTVKLSNAILTNMQSWTPNCLSPENKQMGHMEDISFTYE
KITWTFDPDGIEAEDSWLAPKS
 
Nucleotide Sequence: 489 bp     [Download]
>gi|507517441|ref|NC_021288.1|:c483345-482857 Burkholderia sp. RPE64 DNA, chromosome 3, complete genome
ATGCCGATGCCGTGCTACCTCACGCTCGAAGGCCAGAATCAAGGCAAGATCGAAGGCTCGACCAAGGTTC
AGGGTCATGAAGGGAAGATTCTCGTCCAGGCCGTCGATCACACCATCGAAATTCCGAAGAGCCCGCAAAC
GGGCCTGCCCACCGGCAAGCGCGTGCATCTGCCGATGACGCTGACCAAGGAAATCGACAAGTCGTCGCCG
AAGCTGTTTCAGGCGCTGACGTCGGGCGAGCAGATGAAGGACGTGACGCTCGAGTTCTATCGCATTTCGC
CGAAGGGCACGGAAGAGAAGTACTACACCGTGAAGCTGTCGAACGCGATCCTGACCAACATGCAGTCGTG
GACGCCGAACTGCCTGTCGCCGGAAAACAAGCAGATGGGTCACATGGAAGATATCTCGTTCACGTACGAG
AAGATCACCTGGACGTTCGATCCGGACGGCATCGAAGCAGAAGATTCGTGGCTCGCCCCGAAGTCCTGA

Protein ID: 507517918
SecReT6 ID766
T6SS typei1
Gene symbol-
Locus tagBRPE64_CCDS04770
StrainBurkholderia sp. RPE64
Repliconchromosome III [GenBank: NC_021288] [Browse all T6SS(s) in this replicon]
Location [Strand]486470..486958 [+]
Producthcp protein
NoteTssD
UniProt IDR4WYI0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.40E-41, Aligned region: 6..147
Protein Sequence: 162 a.a.     [Download]
>gi|507517918|ref|YP_008039534.1| hcp protein [Burkholderia sp. RPE64]
MPMPCYLSLEGQNQGKIEGSTKVQGHEGKILVQAVDHTIEIPKSPQTGLPTGKRVHQAMTLSKEIDKSSP
KLYQALTSGEQMKTVSLEFYRISPKGTEEKYYTVNLSNAILTNMKSWTPNCLSPDNRQMGHMEDVSFTYE
KITWTYEPDGIEAEDSWLAPKS
 
Nucleotide Sequence: 489 bp     [Download]
>gi|507517441|ref|NC_021288.1|:486470-486958 Burkholderia sp. RPE64 DNA, chromosome 3, complete genome
ATGCCGATGCCGTGCTACCTCTCGCTCGAAGGCCAAAACCAAGGCAAGATCGAAGGCTCGACCAAGGTTC
AGGGTCATGAAGGAAAGATCCTCGTTCAGGCTGTCGATCACACGATCGAAATCCCGAAGAGCCCGCAAAC
GGGCCTGCCCACCGGCAAGCGCGTGCATCAGGCGATGACGCTCAGCAAGGAAATCGACAAGTCGTCGCCG
AAGCTGTATCAGGCGCTGACCTCCGGCGAACAGATGAAGACCGTGTCGCTCGAGTTCTACCGCATTTCGC
CCAAGGGCACGGAAGAGAAGTACTACACCGTGAATCTGTCGAACGCGATTCTGACCAACATGAAGTCGTG
GACGCCGAATTGCCTCTCGCCCGACAACCGTCAGATGGGCCACATGGAAGACGTGTCCTTCACGTACGAG
AAGATCACGTGGACGTACGAGCCGGACGGCATCGAAGCCGAAGACTCGTGGCTCGCGCCGAAGTCCTGA