SecReT6
Protein ID: 507517914
SecReT6 ID766
T6SS typei1
Gene symbol-
Locus tagBRPE64_CCDS04730
StrainBurkholderia sp. RPE64
Repliconchromosome III [GenBank: NC_021288] [Browse all T6SS(s) in this replicon]
Location [Strand]483546..485033 [-]
Producthypothetical protein
NoteTssC
UniProt IDR4X272
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.50E-185, Aligned region: 68..493
Protein Sequence: 495 a.a.     [Download]
>gi|507517914|ref|YP_008039530.1| putative uncharacterized protein [Burkholderia sp. RPE64]
MSDMEKQQDTAAAPEADASISLLDQLIESARIKPGDEAYSITRQGIQAFIGQLLEPQNAVERITQATVDS
MIADLDQKLCAQVDAILHHADLQKMESAWRSLKFLVDRTNFRENVKIQLLSVSKGKLLEDFEDSADITKS
GLYKNLYTAEYGQFGGQPFGAIVANYEFGPGTQDVKLLQSVASVSAMSHAPFIAAAGPHFFGVDTYDQLP
NLKDLSSIFEGPQFVKWNAFRESEDARYVGLTLPHFLLRVPYGADTVPAKKFNYKEDVSGGNKQFLWGNA
AFAFASRLTSSFADYRWCANVIGPQGGGTVGDLPVYTYESMGELQNKIPTEVLISERREFELAEQGFIAL
TMRKNSDNAAFFSANSAQKPKFFGNTKEGKEAELNYKLSTQLPYMFVVSRLAHYIKVIQRENIGTWKERV
DLESELNTWIRQYVADMDNPAEGVRSRRPLRQAEIVVADVEGDPGWYRVDLKVRPHFKYMGASFTLSLVG
KLDKK
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|507517441|ref|NC_021288.1|:c485033-483546 Burkholderia sp. RPE64 DNA, chromosome 3, complete genome
ATGAGCGACATGGAAAAACAGCAGGACACCGCGGCCGCACCCGAAGCCGATGCAAGCATTTCGCTACTGG
ACCAGCTGATCGAATCGGCACGCATCAAGCCGGGCGACGAAGCCTATTCGATCACGCGTCAGGGCATTCA
GGCGTTCATCGGCCAGTTGCTCGAACCGCAGAACGCCGTGGAGCGCATCACGCAGGCGACGGTCGACAGC
ATGATTGCCGACCTCGATCAGAAGCTCTGCGCACAGGTCGATGCGATCCTGCATCACGCCGACCTGCAGA
AAATGGAATCGGCATGGCGTTCGCTCAAGTTCCTCGTGGACCGCACGAATTTCCGCGAGAACGTCAAGAT
TCAATTGCTGAGCGTGAGCAAGGGCAAGCTTCTCGAAGACTTCGAGGACTCGGCCGACATCACCAAATCC
GGTCTGTACAAGAATCTGTACACGGCCGAATACGGCCAGTTCGGCGGCCAGCCGTTCGGCGCCATCGTGG
CGAACTATGAGTTCGGTCCGGGTACGCAGGACGTGAAGCTGCTGCAAAGCGTGGCGAGCGTGTCGGCGAT
GAGCCATGCGCCGTTCATCGCGGCAGCGGGCCCGCACTTCTTCGGCGTCGATACCTACGATCAGCTTCCG
AACCTCAAAGACCTCTCGTCGATTTTCGAAGGTCCGCAGTTCGTCAAGTGGAACGCCTTCCGTGAATCGG
AAGACGCGCGCTATGTCGGCCTCACGCTGCCGCACTTCCTGCTGCGCGTGCCCTATGGCGCGGATACGGT
CCCGGCCAAGAAGTTCAACTACAAGGAAGACGTCTCGGGCGGCAACAAGCAGTTCCTGTGGGGCAACGCG
GCTTTCGCATTCGCTTCGCGCCTGACGTCGAGCTTCGCCGATTACCGCTGGTGCGCCAACGTGATCGGGC
CGCAAGGCGGCGGCACGGTCGGCGATCTGCCGGTGTACACGTATGAGTCGATGGGCGAGCTGCAAAACAA
GATCCCGACCGAAGTGCTCATCTCCGAGCGCCGCGAGTTCGAGCTTGCCGAGCAGGGCTTCATTGCGCTC
ACCATGCGCAAGAACAGCGACAACGCCGCGTTCTTCTCGGCCAATTCGGCGCAGAAGCCGAAGTTCTTCG
GCAACACCAAGGAAGGCAAGGAAGCCGAGCTGAACTACAAGCTCAGCACGCAGCTACCGTACATGTTCGT
GGTGAGCCGTCTCGCGCACTACATCAAGGTGATTCAGCGCGAGAACATCGGCACGTGGAAAGAGCGCGTC
GATCTCGAAAGCGAACTCAATACGTGGATTCGCCAGTATGTCGCCGACATGGACAACCCGGCAGAAGGCG
TGCGCAGCCGCCGTCCGCTGCGTCAGGCGGAGATCGTCGTGGCCGATGTCGAAGGCGATCCGGGCTGGTA
TCGCGTGGACCTGAAAGTACGTCCGCACTTCAAGTACATGGGCGCGTCGTTCACGCTGTCGCTGGTCGGC
AAGCTGGACAAGAAATAA