SecReT6
Protein ID: 507517915
SecReT6 ID766
T6SS typei1
Gene symbol-
Locus tagBRPE64_CCDS04740
StrainBurkholderia sp. RPE64
Repliconchromosome III [GenBank: NC_021288] [Browse all T6SS(s) in this replicon]
Location [Strand]485035..485484 [-]
Producthypothetical protein
NoteTssB
UniProt IDR4X3P0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.00E-48, Aligned region: 2..145
Protein Sequence: 149 a.a.     [Download]
>gi|507517915|ref|YP_008039531.1| putative uncharacterized protein [Burkholderia sp. RPE64]
MYRPATGDAKAEVELPLKLLVLGDFTLRDDETPIEDMKPVNVDKDNFNEVLKGQKLSLDLAVPNRLDANA
DPDAQLAINLKFDSIDDFSPDAIVEKVPELRQMIALRDALKALKGPLGNIPDFRKRVQELIEDEGVRARL
MSELGIEEK
 
Nucleotide Sequence: 450 bp     [Download]
>gi|507517441|ref|NC_021288.1|:c485484-485035 Burkholderia sp. RPE64 DNA, chromosome 3, complete genome
GTGTATCGTCCGGCCACCGGAGATGCCAAGGCGGAGGTTGAACTGCCGCTCAAATTGCTCGTGCTCGGCG
ACTTCACCTTGCGCGACGACGAGACGCCGATCGAAGACATGAAGCCTGTCAACGTCGACAAGGACAACTT
CAACGAAGTGCTCAAGGGCCAGAAGCTTTCGCTCGATCTCGCGGTGCCGAACCGTCTCGACGCGAACGCC
GACCCGGACGCGCAACTCGCGATCAACCTCAAGTTCGACTCCATCGACGATTTCTCGCCCGATGCGATCG
TCGAGAAAGTGCCCGAGCTGCGCCAGATGATCGCCCTGCGCGACGCGCTCAAGGCGCTCAAGGGACCGCT
CGGCAACATTCCGGATTTCCGCAAGCGCGTTCAGGAACTGATTGAAGACGAAGGCGTGCGCGCGCGTCTG
ATGAGCGAACTCGGCATCGAGGAAAAGTGA