SecReT6
Protein ID: 512615806
SecReT6 ID808
T6SS typei2
Gene symbol-
Locus tagPCA10_01530
StrainPseudomonas resinovorans NBRC 106553
Repliconchromosome [GenBank: NC_021499] [Browse all T6SS(s) in this replicon]
Location [Strand]169138..169641 [+]
Producthypothetical protein
NoteTssB
UniProt IDS6AEF2
KEGG IDpre:PCA10_01530
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.20E-56, Aligned region: 7..159
Protein Sequence: 167 a.a.     [Download]
>gi|512615806|ref|YP_008100490.1| hypothetical protein PCA10_01530 [Pseudomonas resinovorans NBRC 106553]
MASNSFQNEVPKARVNIKLDLHTGGAQKKVELPLKLMLMGDYSNGREARPLSERGKVNIDKNNFDSVLAD
FSPSLKLAVENTLADDASETSVELAFRSMKDFEPEQVARQIPQLRALLAMRNLLRDLKSNLLDNATFRHE
LERILKDDALSDELRAELAALAPQDAR
 
Nucleotide Sequence: 504 bp     [Download]
>gi|512615653|ref|NC_021499.1|:169138-169641 Pseudomonas resinovorans NBRC 106553 DNA, complete geonome
ATGGCATCTAACAGTTTCCAAAACGAAGTGCCCAAGGCAAGGGTCAACATCAAGCTCGACCTGCATACCG
GCGGCGCCCAGAAGAAAGTCGAACTTCCCCTCAAGCTCATGCTGATGGGCGACTACAGCAATGGACGAGA
GGCGCGTCCGCTGTCCGAACGCGGCAAGGTCAACATCGACAAGAACAACTTCGACAGTGTCCTCGCCGAC
TTCTCCCCAAGCCTGAAGCTGGCGGTGGAAAACACCCTGGCCGATGACGCTTCGGAAACCTCCGTCGAAC
TGGCCTTCCGCAGCATGAAGGACTTCGAGCCCGAGCAGGTGGCCCGGCAGATTCCCCAGCTCCGCGCCCT
GCTCGCCATGCGCAATCTGCTGCGCGACCTGAAATCCAACCTGCTGGACAACGCCACGTTCCGCCACGAA
CTGGAACGCATCCTCAAGGACGACGCCCTCAGCGACGAACTGCGCGCCGAACTCGCCGCGCTCGCTCCGC
AAGACGCTCGCTAA