SecReT6
Protein ID: 512615807
SecReT6 ID808
T6SS typei2
Gene symbol-
Locus tagPCA10_01540
StrainPseudomonas resinovorans NBRC 106553
Repliconchromosome [GenBank: NC_021499] [Browse all T6SS(s) in this replicon]
Location [Strand]169672..171210 [+]
Producthypothetical protein
NoteTssC
UniProt IDS6AQ35
KEGG IDpre:PCA10_01540
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.00E-175, Aligned region: 87..508
DUF3135 [PF11333], Evalue: 0.0068, Aligned region: 68..114
Protein Sequence: 512 a.a.     [Download]
>gi|512615807|ref|YP_008100491.1| hypothetical protein PCA10_01540 [Pseudomonas resinovorans NBRC 106553]
MSVEHTSTASHGTTMASGENLGIYASLFSKINLSPIDELGELDAFQDTEALSETSTDERVTAAVSVFLDL
LKKSSQKVERLDKTLLDEHIASLDEQISRQLDAVMHHADFQRVESTWRGVKSLIDQTDFRQNVRIELLDI
SKDHLIQDFEDAPEIAQSGLYVQTYTQEYDTPGGEPIAAAISNYEFGRGPQDIALLRNISKVAAAAHMPF
IGAVGPAFFGKESMEEVAAIKDIGNYFDRAEYIKWKSFRDSDDARYIGLTLPRVLGRLPYGPDTIPVRSF
NYVESVKGPDHNRYLWTNASFAFAANMVKSFISNGWCVQIRGPQSGGAVTDLPIHLYDLGTGNQVKIPSE
VMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHYL
KLIQRENIGTTKDRRVLELELNKWIGGLVTEMTDPSDDLQASHPLREAKVLVEDIDDNPGFFRVKLYAVP
HFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|512615653|ref|NC_021499.1|:169672-171210 Pseudomonas resinovorans NBRC 106553 DNA, complete geonome
ATGTCCGTAGAACACACGTCCACGGCCTCGCACGGCACCACAATGGCCAGCGGGGAAAACCTCGGCATCT
ACGCTTCGCTGTTCAGCAAGATCAACCTCAGCCCCATCGACGAGCTGGGGGAGCTGGACGCATTCCAGGA
CACCGAAGCGTTGTCCGAAACCTCGACCGACGAGCGGGTGACCGCGGCGGTCAGCGTTTTCCTCGATCTG
CTCAAGAAGTCATCGCAGAAGGTCGAGCGCCTCGACAAGACCCTGCTCGATGAACACATCGCCTCCCTCG
ACGAACAGATCAGCCGTCAGCTCGACGCCGTCATGCACCACGCCGATTTCCAGCGTGTCGAGTCCACCTG
GCGTGGCGTCAAGTCGTTGATCGACCAGACCGACTTCCGCCAGAACGTACGCATCGAGCTGCTTGACATC
AGCAAGGACCACTTGATCCAGGACTTCGAGGATGCCCCGGAGATCGCCCAGAGCGGCCTCTACGTGCAGA
CCTACACCCAGGAATACGACACGCCCGGTGGCGAACCGATCGCGGCGGCCATCTCCAACTACGAGTTCGG
TCGCGGCCCGCAGGACATCGCCCTGCTGCGCAATATCTCCAAGGTCGCCGCGGCGGCGCACATGCCCTTC
ATCGGCGCCGTCGGCCCGGCCTTCTTCGGCAAGGAATCGATGGAGGAAGTCGCCGCCATCAAGGACATCG
GCAACTACTTCGATCGCGCCGAGTACATCAAGTGGAAGTCCTTCCGCGACAGCGACGATGCCCGCTACAT
CGGACTGACCCTGCCACGTGTTCTTGGCCGCCTGCCCTACGGCCCGGACACCATTCCCGTGCGCAGCTTC
AACTACGTCGAGAGCGTGAAGGGCCCGGACCACAACCGCTACCTGTGGACCAACGCGTCGTTCGCCTTCG
CCGCCAACATGGTGAAGAGCTTCATCAGCAACGGTTGGTGCGTGCAGATCCGCGGCCCGCAATCGGGCGG
CGCGGTGACCGACCTGCCGATCCACCTCTATGACCTGGGTACCGGCAACCAGGTCAAGATCCCATCGGAA
GTGATGATTCCGGAAACCCGCGAGTTCGAATTCGCCAACCTGGGCTTCATCCCGCTCTCCTATTACAAGA
ACCGCGACTACGCCTGCTTCTTCTCCGCCAACTCGGCGCAGAAACCGGCGCTGTACGACACGGCCGATGC
CACCGCCAACAGTCGCATCAACGCCCGCCTGCCGTACATCTTCCTGCTGTCGCGCATCGCCCACTACCTG
AAGCTGATCCAGCGGGAAAATATCGGTACCACCAAGGACCGCCGCGTGCTGGAGCTGGAGCTGAACAAAT
GGATCGGTGGCCTGGTCACCGAGATGACCGACCCCAGTGACGACCTGCAGGCCTCCCACCCGCTGCGCGA
AGCGAAGGTGCTGGTCGAAGACATCGACGACAACCCCGGCTTCTTCCGCGTCAAGTTGTACGCCGTGCCG
CACTTCCAGGTGGAGGGCATGGACGTCAACCTGTCGCTGGTTTCGCAGATGCCCAAGGCCAAGGCCTGA