SecReT6
Protein ID: 512615808
SecReT6 ID808
T6SS typei2
Gene symbol-
Locus tagPCA10_01550
StrainPseudomonas resinovorans NBRC 106553
Repliconchromosome [GenBank: NC_021499] [Browse all T6SS(s) in this replicon]
Location [Strand]171235..172590 [+]
Producthypothetical protein
NoteTssK
UniProt IDS6ABW3
KEGG IDpre:PCA10_01550
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.30E-139, Aligned region: 18..448
Protein Sequence: 451 a.a.     [Download]
>gi|512615808|ref|YP_008100492.1| hypothetical protein PCA10_01550 [Pseudomonas resinovorans NBRC 106553]
MNIDRPLWAAGTLLSPQQFQQQARWEAWTNECIAQLALAHPWGVLAATFDMDALKLGKLKASRLHLRMPD
GTLIDTDRADRLPPALELSRVLADDTRSATLLLALPLEQGNGNNCILDGGQEDRPTRYRQGWRTVQDLYG
DEEQSVSVMEHQLRLRLGSDDNGEYLTCPVARLTRDAQGNWALDPAYVPPLLSFAAHAGLQTQLENLLTQ
LSAKRQRLMGMRRESNQRMADFAVADVSLFWLLNALNTYQPVLADLRAHPSRHPEQVYLELAKLAGSLLT
FSLEHDIESIPAYRHEQLEAVFPPLMGMISTLLEASLPSRVIALELEESGANRWRVSLNDPRLREPGGAD
FYLSVRSRLPAAQVQSQLPRLCKVGSPDDVDHLVNAALDGVPLQPLNHVPAAIPLRLENQYFALDLGHPK
GRAMLAAGVCAFYVPATLLDARLELFAVLRS
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|512615653|ref|NC_021499.1|:171235-172590 Pseudomonas resinovorans NBRC 106553 DNA, complete geonome
ATGAACATCGACCGCCCCCTATGGGCTGCGGGGACGCTCCTGTCCCCGCAGCAGTTCCAGCAGCAAGCGC
GCTGGGAGGCCTGGACCAACGAATGCATCGCCCAGCTCGCACTGGCGCACCCCTGGGGTGTGCTCGCGGC
CACATTCGACATGGACGCGCTGAAACTTGGAAAGCTCAAGGCTTCCCGGCTTCACCTGCGGATGCCGGAT
GGCACCCTGATCGACACGGACCGCGCCGATCGCCTGCCGCCTGCACTGGAACTGTCCCGCGTGCTGGCCG
ACGACACCCGGAGCGCCACATTGTTGCTGGCGTTGCCACTGGAACAGGGCAACGGCAACAACTGCATCCT
CGACGGCGGCCAGGAGGACCGGCCCACGCGCTACCGCCAGGGCTGGCGCACGGTGCAGGACCTCTACGGC
GACGAAGAGCAGTCCGTCAGCGTGATGGAGCACCAGCTCCGTCTGCGCCTGGGCAGCGATGACAACGGTG
AATACCTGACGTGCCCGGTCGCTCGCCTGACCCGTGACGCCCAGGGCAACTGGGCGCTCGATCCCGCGTA
CGTACCGCCGCTGCTGAGCTTCGCCGCCCACGCCGGGCTCCAGACGCAACTGGAAAACCTGCTCACTCAG
CTGTCCGCCAAGCGCCAACGGCTGATGGGCATGCGCCGCGAGAGCAACCAACGTATGGCCGACTTCGCCG
TGGCCGACGTCTCGCTGTTCTGGCTGCTCAATGCGCTCAATACCTACCAGCCGGTCCTCGCCGACCTGCG
GGCGCATCCCTCGCGTCACCCGGAGCAGGTCTACCTGGAACTGGCGAAGCTTGCCGGCAGCCTGCTGACC
TTCTCGCTGGAACATGACATCGAGAGCATTCCGGCGTACCGGCACGAGCAACTGGAAGCGGTCTTCCCGC
CACTGATGGGCATGATCTCCACCCTGCTCGAAGCCAGCCTGCCATCGCGGGTCATCGCGTTGGAGCTGGA
AGAGAGCGGCGCCAATCGCTGGCGGGTGTCCCTCAACGATCCGCGCCTGCGCGAGCCGGGCGGCGCCGAC
TTCTACCTGTCCGTGCGCTCGCGCCTGCCGGCGGCGCAGGTGCAGAGCCAGCTACCGCGCCTATGCAAGG
TCGGCAGCCCGGATGACGTCGATCATCTGGTCAACGCGGCGCTCGATGGCGTACCGCTGCAACCGCTCAA
CCATGTCCCGGCCGCCATCCCGCTGCGCCTGGAAAACCAGTACTTCGCGCTCGACCTCGGGCATCCCAAG
GGCCGGGCCATGTTGGCTGCGGGCGTCTGTGCCTTCTATGTCCCCGCCACGCTGCTGGATGCGAGGCTCG
AACTGTTTGCGGTGCTGCGCTCATGA