SecReT6
Protein ID: 512615809
SecReT6 ID808
T6SS typei2
Gene symbol-
Locus tagPCA10_01560
StrainPseudomonas resinovorans NBRC 106553
Repliconchromosome [GenBank: NC_021499] [Browse all T6SS(s) in this replicon]
Location [Strand]172587..173267 [+]
Producthypothetical protein
NoteTssL
UniProt IDS6AKZ4
KEGG IDpre:PCA10_01560
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.50E-43, Aligned region: 15..214
DUF4473 [PF14747], Evalue: 0.002, Aligned region: 49..69
Protein Sequence: 226 a.a.     [Download]
>gi|512615809|ref|YP_008100493.1| hypothetical protein PCA10_01560 [Pseudomonas resinovorans NBRC 106553]
MSPNSNSRRLPAIDIDALLQDSYLLVVSLREGAMTRSGRDLWAHCSEQIEAVRQELQAAGMSQRSIDHIS
YAQCALLDETVLGFATDQAHAEWAGEPLQAKFFNRHQAGEFLYEDMHEVLREPAPDPQVLTAYQRVLMLG
FKGRYRDLQHPEREQLLQTLDARVAPLATHHELVCGSARGWGAPMSRALRSPIIQLCAAAALLAGAWWGL
NHLLVNSVAALMPGAL
 
Nucleotide Sequence: 681 bp     [Download]
>gi|512615653|ref|NC_021499.1|:172587-173267 Pseudomonas resinovorans NBRC 106553 DNA, complete geonome
ATGAGTCCGAACAGCAACAGCCGCCGGCTCCCGGCGATCGACATCGATGCGTTGCTGCAGGACAGCTACC
TCCTGGTGGTGTCCCTGCGCGAGGGCGCGATGACACGCAGCGGCCGCGATCTGTGGGCCCACTGTTCCGA
GCAGATCGAAGCGGTCCGCCAGGAACTGCAAGCAGCCGGCATGAGCCAGCGGAGCATCGACCACATCAGC
TACGCCCAGTGCGCCTTGCTGGATGAAACCGTGCTCGGCTTCGCCACGGACCAAGCCCACGCCGAGTGGG
CCGGCGAACCCCTGCAGGCGAAGTTCTTCAACCGCCACCAGGCCGGAGAGTTCCTCTATGAGGACATGCA
CGAAGTCCTTCGTGAACCCGCGCCGGATCCCCAGGTGCTGACGGCCTACCAACGCGTGCTGATGCTGGGA
TTCAAGGGGCGTTACCGCGACCTGCAGCACCCGGAACGGGAGCAATTGCTGCAGACCCTCGATGCCCGGG
TGGCGCCATTGGCGACGCACCACGAGTTGGTCTGCGGCTCCGCTCGAGGGTGGGGCGCCCCTATGTCGCG
CGCGCTGCGCAGCCCGATCATCCAGCTGTGCGCGGCTGCAGCGCTGCTGGCAGGCGCCTGGTGGGGGCTG
AATCACCTGCTCGTCAACTCGGTCGCCGCACTGATGCCGGGTGCGCTGTGA