SecReT6
Protein ID: 512615812
SecReT6 ID808
T6SS typei2
Gene symbolclpV
Locus tagPCA10_01590
StrainPseudomonas resinovorans NBRC 106553
Repliconchromosome [GenBank: NC_021499] [Browse all T6SS(s) in this replicon]
Location [Strand]175600..178248 [+]
Productputative type VI secretion system ATPase
NoteTssH
UniProt IDS6AQ38
KEGG IDpre:PCA10_01590
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 9.20E-40, Aligned region: 231..251
AAA_2 [PF07724], Evalue: 9.20E-40, Aligned region: 606..770
AAA [PF00004], Evalue: 1.30E-18, Aligned region: 233..346
AAA [PF00004], Evalue: 1.30E-18, Aligned region: 611..736
ClpB_D2-small [PF10431], Evalue: 6.30E-14, Aligned region: 473..501
ClpB_D2-small [PF10431], Evalue: 6.30E-14, Aligned region: 777..852
AAA_5 [PF07728], Evalue: 1.40E-13, Aligned region: 233..257
AAA_5 [PF07728], Evalue: 1.40E-13, Aligned region: 307..363
AAA_5 [PF07728], Evalue: 1.40E-13, Aligned region: 610..729
AAA_22 [PF13401], Evalue: 8.70E-10, Aligned region: 35..78
AAA_22 [PF13401], Evalue: 8.70E-10, Aligned region: 232..318
AAA_22 [PF13401], Evalue: 8.70E-10, Aligned region: 607..631
AAA_22 [PF13401], Evalue: 8.70E-10, Aligned region: 672..704
AAA_16 [PF13191], Evalue: 3.50E-09, Aligned region: 98..104
AAA_16 [PF13191], Evalue: 3.50E-09, Aligned region: 210..254
AAA_16 [PF13191], Evalue: 3.50E-09, Aligned region: 278..312
AAA_16 [PF13191], Evalue: 3.50E-09, Aligned region: 477..490
AAA_16 [PF13191], Evalue: 3.50E-09, Aligned region: 579..654
AAA_16 [PF13191], Evalue: 3.50E-09, Aligned region: 675..705
AAA_16 [PF13191], Evalue: 3.50E-09, Aligned region: 749..800
AAA_25 [PF13481], Evalue: 2.80E-08, Aligned region: 232..308
AAA_25 [PF13481], Evalue: 2.80E-08, Aligned region: 606..639
Clp_N [PF02861], Evalue: 3.60E-06, Aligned region: 23..74
Clp_N [PF02861], Evalue: 3.60E-06, Aligned region: 112..124
NACHT [PF05729], Evalue: 8.40E-06, Aligned region: 233..329
NACHT [PF05729], Evalue: 8.40E-06, Aligned region: 610..631
IstB_IS21 [PF01695], Evalue: 1.00E-05, Aligned region: 227..294
IstB_IS21 [PF01695], Evalue: 1.00E-05, Aligned region: 610..630
AAA_19 [PF13245], Evalue: 1.60E-05, Aligned region: 230..255
AAA_19 [PF13245], Evalue: 1.60E-05, Aligned region: 606..632
Zeta_toxin [PF06414], Evalue: 2.00E-05, Aligned region: 233..257
Zeta_toxin [PF06414], Evalue: 2.00E-05, Aligned region: 601..650
Sigma54_activat [PF00158], Evalue: 0.00011, Aligned region: 229..249
Sigma54_activat [PF00158], Evalue: 0.00011, Aligned region: 609..727
AAA_14 [PF13173], Evalue: 0.00012, Aligned region: 233..334
AAA_14 [PF13173], Evalue: 0.00012, Aligned region: 608..700
AAA_18 [PF13238], Evalue: 0.00021, Aligned region: 233..255
AAA_18 [PF13238], Evalue: 0.00021, Aligned region: 611..636
Arch_ATPase [PF01637], Evalue: 0.00023, Aligned region: 211..248
Arch_ATPase [PF01637], Evalue: 0.00023, Aligned region: 285..382
Arch_ATPase [PF01637], Evalue: 0.00023, Aligned region: 604..626
Arch_ATPase [PF01637], Evalue: 0.00023, Aligned region: 681..696
AAA_17 [PF13207], Evalue: 0.0015, Aligned region: 134..219
AAA_17 [PF13207], Evalue: 0.0015, Aligned region: 233..335
AAA_17 [PF13207], Evalue: 0.0015, Aligned region: 470..524
AAA_17 [PF13207], Evalue: 0.0015, Aligned region: 609..645
AAA_17 [PF13207], Evalue: 0.0015, Aligned region: 793..811
AAA_29 [PF13555], Evalue: 0.006, Aligned region: 228..249
AAA_29 [PF13555], Evalue: 0.006, Aligned region: 606..621
SRP54 [PF00448], Evalue: 0.0085, Aligned region: 233..254
SRP54 [PF00448], Evalue: 0.0085, Aligned region: 515..544
SRP54 [PF00448], Evalue: 0.0085, Aligned region: 609..639
DUF258 [PF03193], Evalue: 0.0093, Aligned region: 228..251
DUF258 [PF03193], Evalue: 0.0093, Aligned region: 608..623
Protein Sequence: 882 a.a.     [Download]
>gi|512615812|ref|YP_008100496.1| putative type VI secretion system ATPase [Pseudomonas resinovorans NBRC 106553]
MAQNSASLLRRLNPYCARALGAAASLCQSRGHRQITLEHWLLKLLEQGEGDLTLIARRYEWDLDALWRAL
LDHLDGLPRSVHDKPQLGGKLQQLIKNAWLRASLDDDNDRLRSLHLLGALLESPSLLECEAAWPLLSLTD
AQLQRLVPLLDQHSEERPEVQREAGLSGDEPRVAPLAAPSTGTDGALQALLDKYTQDVTAKAREGRIDPV
FGRDDEIRQVIDILGRRRKNNPILVGDPGVGKTALVEGLALRIAEGNVPDSLKPMSVRTLDLGLLQAGAG
VKGEFEQRLKHIIDAVQQAQHPILLFIDEAHTLIGAGNQAGGADAANLLKPALARGELRTIAATTWSEYK
QYFERDAALERRFQVVKVDEPDDANACLMLRGLKARYASHHGVHIEDGAVQAAVSLSRRYLTGRQLPDKA
VDLLDTASARVRMSLDCEPQALVRIKASQAALELEQQALEADARLGGRAPADRLDEIAAEHAELARQRVE
LERRYRLELDLSLQLLDARQEEPRQPERCAELQRRLEAAQRDQALLSLDVTARNVAEVVADWTGVPLGSL
LKDEQASLLELERQLGQRVIGQDHALGALAQRLRAARTGLTDEKAPQGVFLLVGTSGVGKTETALALADS
LFGGEKSLITLNLSEYQEAHTVSQLKGSPPGYVGYGQGGVLTEAVRQRPYSVVLLDEVEKAHRDVLNLFY
QVFDRGFMRDGEGREIDFRNTVILMTSNLGSDLLEACLHEQPDATDGTLQELLRPVLREHFQPALLARFQ
TLVYRPLQADSLKRIVDIKLARVASRLQRHYGLGCHIDDALGDALVAACLLPDSGARNIDSLLNQQILPV
LSQQLLQRQAVQQATRGVCLGYSLEDGVTLHFTDRLEQPEEA
 
Nucleotide Sequence: 2649 bp     [Download]
>gi|512615653|ref|NC_021499.1|:175600-178248 Pseudomonas resinovorans NBRC 106553 DNA, complete geonome
ATGGCCCAGAACTCCGCCAGCCTGCTTCGCCGCCTCAACCCCTACTGCGCCCGGGCGCTCGGTGCCGCGG
CCTCGTTGTGCCAGAGCCGCGGCCATAGGCAGATCACCCTCGAACACTGGCTGCTCAAGCTGCTGGAGCA
AGGGGAGGGAGACCTCACGCTCATCGCGCGTCGCTACGAGTGGGATCTCGATGCGCTCTGGCGTGCGCTG
CTCGACCACCTGGACGGCCTGCCCCGCAGCGTGCATGACAAGCCCCAGCTTGGCGGCAAGCTCCAGCAAC
TGATCAAGAACGCCTGGCTGCGTGCCTCGCTCGACGATGACAACGACAGGCTGCGCTCGCTGCACCTGCT
CGGTGCCTTGCTGGAGTCGCCCAGCCTGCTCGAGTGCGAGGCTGCCTGGCCGTTGCTCAGCCTCACCGAC
GCCCAGTTGCAGCGCTTGGTGCCGCTGCTGGACCAGCACTCCGAGGAGCGCCCCGAGGTCCAACGCGAGG
CTGGCCTCTCAGGGGACGAGCCCCGTGTCGCGCCACTGGCCGCTCCCTCCACCGGAACCGACGGTGCCCT
GCAAGCGCTGCTCGACAAGTACACCCAGGACGTGACCGCCAAGGCGCGGGAGGGGCGTATCGATCCGGTG
TTCGGACGCGACGACGAAATCCGCCAGGTCATCGATATCCTGGGCCGGCGGCGCAAGAACAACCCCATCC
TGGTCGGCGATCCCGGCGTCGGCAAGACCGCGCTGGTGGAGGGCCTGGCCCTGCGCATCGCCGAAGGCAA
CGTCCCCGACAGCCTGAAGCCCATGAGCGTGCGCACCCTCGACCTCGGCCTGCTGCAAGCCGGCGCAGGC
GTCAAGGGCGAGTTCGAACAACGCCTGAAGCACATCATCGATGCGGTGCAGCAAGCGCAACACCCCATCC
TGCTGTTCATCGACGAGGCCCACACCCTGATCGGCGCCGGCAACCAGGCGGGGGGCGCCGATGCCGCCAA
CCTGCTGAAACCCGCGCTCGCCCGAGGCGAGCTGCGCACCATCGCCGCCACCACCTGGAGCGAGTACAAG
CAGTACTTCGAGCGCGACGCGGCGCTGGAACGGCGCTTTCAGGTGGTCAAGGTCGACGAGCCCGACGACG
CCAACGCCTGCCTCATGCTGCGCGGCCTCAAGGCCCGCTACGCCAGCCACCACGGCGTGCACATCGAGGA
CGGGGCGGTGCAGGCGGCGGTCAGCCTGTCGCGGCGCTACCTGACCGGCCGGCAACTGCCCGACAAGGCA
GTCGACCTGCTGGATACCGCCAGTGCCCGGGTACGCATGAGCCTCGATTGCGAGCCCCAGGCGCTGGTTC
GCATCAAGGCGAGCCAGGCCGCGCTGGAACTGGAACAGCAGGCCCTGGAGGCCGACGCCCGCCTGGGCGG
CAGGGCCCCTGCCGATCGGTTGGACGAAATCGCCGCCGAGCACGCCGAACTCGCGCGGCAGCGCGTGGAA
CTGGAGCGTCGCTATCGCCTCGAACTCGACCTGAGCCTGCAACTGCTCGATGCGCGCCAGGAAGAGCCCC
GCCAGCCGGAGCGCTGCGCCGAGCTGCAGCGGCGGCTGGAGGCGGCGCAGCGCGATCAGGCGCTGCTGTC
CCTCGATGTCACCGCGCGCAACGTCGCCGAAGTGGTCGCCGACTGGACCGGGGTGCCCCTGGGCAGCCTG
CTCAAGGACGAACAGGCCAGCCTGCTGGAGCTGGAGCGGCAGCTCGGCCAACGGGTCATCGGCCAGGATC
ACGCCCTCGGCGCCCTGGCCCAGCGCCTGCGCGCCGCACGCACCGGCCTGACCGATGAGAAGGCGCCCCA
GGGGGTGTTCCTGCTGGTGGGCACCAGCGGCGTCGGCAAGACCGAAACCGCCCTGGCGCTGGCCGACAGC
CTGTTCGGCGGCGAAAAATCGCTGATCACCCTGAACCTCTCCGAGTACCAGGAAGCCCACACCGTCAGCC
AGCTCAAGGGCTCACCGCCGGGCTATGTCGGCTACGGCCAGGGCGGGGTGCTCACCGAAGCGGTACGCCA
GCGGCCCTACAGCGTGGTGCTGCTCGACGAGGTGGAGAAGGCCCATCGCGATGTGCTCAACCTGTTCTAC
CAGGTCTTCGACCGTGGCTTCATGCGCGATGGCGAAGGCCGCGAAATCGATTTCCGCAACACCGTCATCC
TGATGACCTCCAACCTGGGCAGCGACCTGCTCGAGGCCTGCCTGCACGAACAACCCGACGCCACCGACGG
CACCTTGCAGGAGCTGCTGCGCCCGGTCCTGCGCGAGCACTTCCAGCCGGCGCTGCTGGCGCGCTTCCAG
ACCCTGGTCTACCGCCCACTGCAGGCCGACTCACTCAAGCGCATCGTCGACATCAAGCTCGCCCGGGTCG
CCAGCCGCCTGCAGCGTCACTACGGCCTGGGCTGCCACATCGACGACGCCCTCGGCGATGCCCTGGTTGC
CGCCTGCCTGCTACCGGACAGCGGCGCCCGCAACATCGACAGCCTGCTCAACCAGCAGATCCTCCCGGTG
CTCAGCCAGCAGCTCCTGCAACGCCAGGCCGTCCAGCAGGCTACCCGGGGTGTTTGCCTGGGCTACAGCC
TTGAGGACGGCGTCACCCTGCACTTCACCGACCGGCTGGAACAGCCCGAGGAAGCCTGA