SecReT6
Protein ID: 512615813
SecReT6 ID808
T6SS typei2
Gene symbol-
Locus tagPCA10_01600
StrainPseudomonas resinovorans NBRC 106553
Repliconchromosome [GenBank: NC_021499] [Browse all T6SS(s) in this replicon]
Location [Strand]178251..180644 [+]
Producthypothetical protein
NoteTssI
UniProt IDS6ABW5
KEGG IDpre:PCA10_01600
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.70E-64, Aligned region: 33..361
Phage_GPD [PF05954], Evalue: 2.70E-64, Aligned region: 470..544
DUF2345 [PF10106], Evalue: 2.50E-41, Aligned region: 614..764
T6SS_Vgr [PF13296], Evalue: 2.80E-37, Aligned region: 494..599
T6SS_Vgr [PF13296], Evalue: 2.80E-37, Aligned region: 637..680
Phage_base_V [PF04717], Evalue: 2.60E-17, Aligned region: 393..488
Sarcoglycan_1 [PF04790], Evalue: 0.00028, Aligned region: 635..687
Sarcoglycan_1 [PF04790], Evalue: 0.00028, Aligned region: 692..738
DUF3540 [PF12059], Evalue: 0.0019, Aligned region: 640..681
DUF3540 [PF12059], Evalue: 0.0019, Aligned region: 718..758
Protein Sequence: 797 a.a.     [Download]
>gi|512615813|ref|YP_008100497.1| hypothetical protein PCA10_01600 [Pseudomonas resinovorans NBRC 106553]
MLAERRPFFDHSRHKLQVRGLDAALDVLAFTGTEALSEPFSYQVEFTSSERDLPAEQLLGQRASFSLHPP
PSPLPFAGLSLPPAQPLRTLHGVVTGFRRLSGSNDEARYEVTLQPRLALLGRGRQYRIYQHLSVPEIVNQ
ILRSERHQWAGQDFFFDLTREYPKREQVMQYGESDLAFITRLLAEVGIWYRFTADERLNIDVVQFHDDQR
NYQFDVRLPYRPPSGTSASGQDAVWALQSQHGVVEKDIHVRAYDPRDAAARLDGDVDQSRGDPTTYGEAY
HYAEHYTELGDAYAQDEDLQSESGYFFARLRHERYLNARTRLAGIASSATLAPGQVLGIDGGAPEAFAPG
AVITRLTASAARDRSFEARFEAIPYVEHICFRPLLKQRPLIVGTIPARVTSPQPDDLYSHIDLEGRYKVN
FLFDRDTWPAGQESMWLRLARPYAGDTHGLHLPLIQGTEVAIAFEHGDPDKGFIAFALHDSRHPDHVTLN
NYKRNVLRTPANNKLRLDDTRGQEHIKLSTEHSGKSQLNLGHLVDAQRQKRGEGFELRTDNWGALRAGKG
LFISADEQTKAGGQVLDMEPADALVESAQQQMANWRDIADSHHSRPPAVDGLTQLRADAKGLAGSAILLS
APQGIGAVTPASLLLRSGDSLYVQSQEEINLAAAQRLSVQANQAISLLAQQEGMRLVSGKGPLEIESHGD
LLNLIAQQDITVQSVQGHLQLTAKNGITLACGGGYIRITPSGAIDIHSPGTLNLKGRHVWEKPASQSFPL
PELPQSVCEECLKAARKAAEGAVLSGR
 
Nucleotide Sequence: 2394 bp     [Download]
>gi|512615653|ref|NC_021499.1|:178251-180644 Pseudomonas resinovorans NBRC 106553 DNA, complete geonome
ATGCTCGCCGAACGCCGTCCCTTCTTCGACCACAGCCGCCACAAGCTCCAGGTCCGTGGCCTCGACGCCG
CCCTCGACGTGCTCGCCTTCACGGGCACGGAAGCCCTCAGCGAGCCCTTCAGCTACCAGGTGGAATTCAC
CTCCAGCGAGCGTGACCTCCCCGCCGAGCAGCTGCTGGGTCAGCGCGCCAGCTTCAGCCTGCATCCGCCG
CCCAGCCCGTTGCCCTTCGCCGGCCTGAGCCTGCCGCCGGCCCAGCCCTTGCGCACCCTGCATGGGGTGG
TCACGGGCTTTCGCCGCCTCTCCGGCTCCAACGACGAAGCCCGCTACGAAGTCACCCTGCAACCGCGCCT
GGCCTTGCTCGGACGCGGCCGCCAATACCGCATCTACCAGCACCTCTCGGTGCCCGAGATCGTCAATCAG
ATCCTGCGCAGCGAGCGCCACCAGTGGGCGGGGCAGGACTTCTTCTTCGACCTCACGCGCGAGTACCCCA
AGCGCGAACAGGTGATGCAGTACGGCGAGAGCGACCTGGCCTTCATCACCCGCCTGCTGGCCGAAGTCGG
CATCTGGTACCGCTTCACCGCCGACGAGCGGTTGAACATCGACGTCGTCCAGTTCCACGACGACCAGCGC
AACTACCAGTTCGATGTTCGCCTGCCGTACCGCCCGCCGTCCGGCACCAGCGCCAGCGGGCAGGACGCGG
TCTGGGCCCTGCAATCGCAGCATGGCGTGGTGGAAAAGGACATCCACGTCCGCGCCTACGACCCACGCGA
TGCCGCCGCCCGGCTCGACGGCGATGTCGACCAGAGCCGGGGCGACCCCACCACCTACGGCGAGGCCTAC
CACTACGCCGAGCACTACACCGAACTGGGCGACGCCTACGCCCAGGACGAAGACCTGCAAAGCGAGAGCG
GCTACTTCTTCGCTCGCCTGCGGCACGAGCGCTACCTCAATGCCCGTACCCGCCTCGCCGGCATCGCCAG
CAGCGCGACCCTGGCCCCCGGGCAGGTGCTGGGAATCGACGGCGGCGCCCCCGAGGCCTTCGCCCCCGGC
GCCGTCATCACTCGCCTGACCGCCAGCGCCGCCCGCGACCGCAGCTTCGAAGCCCGCTTCGAGGCCATTC
CCTATGTCGAGCACATCTGCTTCCGCCCGCTGTTGAAGCAAAGGCCGCTGATCGTCGGCACCATCCCGGC
GCGGGTCACCAGCCCGCAGCCCGACGACCTCTACAGCCACATCGACCTGGAAGGCCGCTACAAGGTCAAC
TTCCTCTTCGACCGCGACACCTGGCCCGCCGGCCAGGAAAGCATGTGGCTGCGCCTGGCCCGCCCCTACG
CCGGGGACACCCATGGGCTGCACCTGCCGCTGATCCAGGGCACCGAGGTGGCCATCGCCTTCGAGCACGG
CGACCCCGACAAGGGTTTCATCGCCTTCGCCCTGCACGACAGCCGGCACCCCGACCACGTCACCCTGAAC
AACTACAAGCGCAACGTCCTGCGCACCCCGGCCAACAACAAACTGCGCCTGGACGACACCCGCGGCCAGG
AGCACATCAAGCTCAGCACCGAACACAGCGGCAAGAGCCAGCTCAACCTCGGCCACCTGGTGGACGCGCA
GCGGCAGAAGCGCGGCGAAGGCTTCGAATTGCGCACCGATAACTGGGGCGCCCTGCGGGCAGGTAAGGGT
TTGTTCATCAGTGCCGATGAACAAACCAAGGCGGGCGGCCAGGTACTGGACATGGAGCCCGCCGACGCCC
TGGTGGAAAGCGCCCAGCAGCAAATGGCCAACTGGCGCGACATCGCCGACAGCCACCACAGCCGCCCGCC
GGCCGTGGACGGCCTCACGCAACTGCGCGCCGACGCCAAGGGCTTGGCCGGCTCGGCCATCCTGCTCAGC
GCCCCCCAGGGCATCGGTGCAGTCACCCCCGCCAGCCTGTTGCTCAGGAGCGGCGACTCGCTCTATGTGC
AAAGCCAGGAGGAAATCAATCTGGCCGCCGCCCAGCGCCTTTCCGTCCAGGCCAACCAGGCCATCTCCCT
GCTGGCCCAGCAGGAAGGCATGCGCCTGGTGTCCGGCAAGGGCCCGCTGGAAATCGAATCCCACGGCGAC
CTGCTCAACCTCATCGCCCAGCAGGACATCACCGTGCAGTCCGTGCAGGGCCACCTCCAGCTCACCGCGA
AGAACGGCATCACCCTGGCCTGTGGCGGCGGTTACATCCGCATCACACCCAGCGGCGCCATCGATATCCA
CAGCCCCGGTACGCTCAACCTCAAGGGCCGGCATGTGTGGGAAAAGCCCGCCAGCCAAAGCTTCCCGCTG
CCCGAACTGCCGCAGTCGGTGTGCGAGGAGTGCCTGAAAGCGGCGCGCAAGGCTGCCGAAGGAGCCGTGC
TCAGTGGACGTTGA