SecReT6
Protein ID: 512615825
SecReT6 ID808
T6SS typei2
Gene symbol-
Locus tagPCA10_01720
StrainPseudomonas resinovorans NBRC 106553
Repliconchromosome [GenBank: NC_021499] [Browse all T6SS(s) in this replicon]
Location [Strand]191645..193228 [+]
Producthypothetical protein
NoteTssA
UniProt IDS6BA09
KEGG IDpre:PCA10_01720
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 65..124
ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 158..180
ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 319..328
Protein Sequence: 527 a.a.     [Download]
>gi|512615825|ref|YP_008100509.1| hypothetical protein PCA10_01720 [Pseudomonas resinovorans NBRC 106553]
MSLSSLIASCLGQRDAQALARRQAPDWEAWLQPVDARSAVGEDPGYDDDFQHMREEVNKLSGADAELVAR
LAEKLLKHRCKDLRVATYYLWARMQKDGEAGLADGLSLLAALVERFSADILPKRPNSRRMALEWLASAKV
LDGLSLYPEVVKAEAERTVAALAWLEQGLGSWPEDQRPALGALYGALSSRLAQSGGVDALVPQNSASHET
SRQGAAPVAAAIRSGRDLLDSGRALAGYLREQPLGWLAAHRLMKSLRWDSVHQTPPAEADGITRLTPPRS
DYRAQLKRLFLQQSWSELLDQVERIYAEGVNHFWLDLQWYLCQALAKQPAPQDGWADIAKRDLGMLLDRL
PGLESLRWSDGSPFADETTRDWIAQQVSGNRSPQWLPAPAMPVRGDDDILALEGEALAQADSDGVEAAIA
WLGDRPGLHSGRQRWLLRLLMARVAEQCGKTDLAIHLLTELESTAQRLALVEWESDLTFEVQARLLKLLR
LKAQRNDADKAALGRRQEALLASLVGIDPVRAAVLCG
 
Nucleotide Sequence: 1584 bp     [Download]
>gi|512615653|ref|NC_021499.1|:191645-193228 Pseudomonas resinovorans NBRC 106553 DNA, complete geonome
ATGAGCCTGTCCTCGCTCATCGCCAGCTGCCTGGGGCAGCGCGATGCCCAGGCGCTGGCCCGGCGCCAGG
CGCCCGACTGGGAAGCCTGGCTGCAGCCGGTCGACGCCCGGTCGGCGGTCGGCGAAGACCCCGGCTACGA
CGACGACTTCCAGCACATGCGCGAGGAGGTCAACAAGCTCTCGGGCGCCGATGCCGAGTTGGTGGCGCGG
CTGGCGGAGAAGCTGCTCAAGCACCGCTGCAAGGACCTGCGGGTAGCGACCTACTACCTCTGGGCGCGCA
TGCAGAAGGACGGCGAGGCCGGCCTGGCCGATGGCTTGAGCCTGCTGGCCGCGCTGGTGGAGCGGTTCTC
CGCCGACATCCTGCCGAAGCGGCCCAACAGCCGCCGCATGGCCCTGGAGTGGCTGGCCAGCGCCAAGGTG
CTGGACGGCCTGTCGCTCTACCCGGAGGTGGTGAAGGCCGAGGCTGAGCGCACCGTGGCGGCCCTCGCCT
GGCTGGAACAGGGCCTGGGATCCTGGCCGGAGGACCAGCGGCCGGCATTGGGAGCGCTCTACGGTGCCCT
GTCGAGCCGTCTTGCGCAGTCCGGCGGGGTCGACGCGCTGGTGCCGCAGAACAGCGCCAGCCACGAGACG
AGTCGGCAGGGCGCCGCTCCCGTGGCCGCCGCCATCAGGTCTGGCCGTGACCTGCTGGACAGCGGCCGGG
CCCTGGCCGGCTACCTGCGTGAACAACCGCTGGGCTGGCTGGCCGCGCACCGGTTGATGAAGAGCCTGCG
CTGGGACAGCGTGCACCAGACACCGCCCGCCGAGGCCGACGGCATTACCCGGCTCACGCCACCGCGTAGC
GACTACCGGGCCCAGCTCAAGCGCCTGTTCCTGCAGCAGAGCTGGAGCGAACTGCTCGATCAGGTCGAGC
GCATCTATGCCGAAGGGGTCAACCACTTCTGGCTCGACCTGCAGTGGTACCTGTGCCAGGCGCTGGCCAA
ACAGCCGGCGCCGCAGGATGGCTGGGCCGATATCGCCAAGCGCGACCTGGGCATGCTGCTCGACCGTTTG
CCGGGCCTGGAATCCCTGCGCTGGAGCGATGGCTCGCCATTCGCCGACGAGACCACCCGCGACTGGATCG
CCCAGCAGGTGAGCGGCAATCGCTCGCCGCAATGGCTGCCGGCGCCGGCCATGCCGGTGCGGGGGGATGA
CGACATCCTCGCCCTCGAGGGGGAAGCGCTGGCCCAGGCCGACAGCGATGGCGTGGAAGCGGCTATCGCC
TGGCTGGGCGACCGGCCAGGCCTGCACAGCGGCCGCCAGCGCTGGCTGCTGCGCCTCTTGATGGCGCGCG
TCGCCGAGCAGTGCGGCAAGACCGATCTGGCCATCCACCTGCTGACGGAACTGGAGTCCACGGCGCAGCG
CCTGGCCCTGGTGGAGTGGGAGTCGGATCTGACCTTCGAGGTGCAGGCGCGCCTGCTCAAGCTGCTGCGC
CTGAAGGCCCAGCGCAACGATGCGGACAAGGCGGCCCTCGGGCGCCGCCAGGAAGCCCTGCTGGCCTCGC
TGGTCGGCATCGACCCGGTGCGCGCCGCCGTGCTCTGCGGCTAG