SecReT6
Protein ID: 512615826
SecReT6 ID808
T6SS typei2
Gene symbol-
Locus tagPCA10_01730
StrainPseudomonas resinovorans NBRC 106553
Repliconchromosome [GenBank: NC_021499] [Browse all T6SS(s) in this replicon]
Location [Strand]193256..195025 [+]
Producthypothetical protein
NoteTssF
UniProt IDS6AEG2
KEGG IDpre:PCA10_01730
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.30E-183, Aligned region: 8..586
Protein Sequence: 589 a.a.     [Download]
>gi|512615826|ref|YP_008100510.1| hypothetical protein PCA10_01730 [Pseudomonas resinovorans NBRC 106553]
MDMDNLTLRYFDAEMRYLREAGQEFAEAFPDRAAQLNLDRPGARDPYVERLFEGFAFLMGRLREKLDDDL
PELTEGLVSLLWPHYLRTIPSLSIVELAPDLQQMKRSERIEKGMEVLSRPVGPKRTRCRYTTTQNLTLQP
LAVESLRLAHEPDGRSLLRLRLACGPLTEWAQVDLSRLPLYLNADAPVASALHLALTRQTQALYVRLPGD
PERRPLDGYFATKGFAEDDRLWPKGDSAFSGYQLLLEYFSFREKFMFVTLHGLERLVVPEGAPWFEIEVV
LGEGWPHDFEPRAEHVRLHAVPVINLFELEADPLRLDPLQGDYLLRPMRLQDGHTEIYSVDQVSASKNAE
RVDYVPFSSFRHKGGMLRDDAPERYFHTRLKRGANGLHDTWLILGGEGFDVDRLVAGESLSLRLTGTNGQ
LPRKALQSTLLDTPVQSTQTGLRVLNLCAPTMPCYPPSRDRFHWRVLSHLGSNFLPMLDNAEVLRGTLAL
YDWTGSELNRRRLEALVDVRHHLIQRFEKGFLLRGVDIEVTLDANGFSGEGDISLFGEMLNRFFALYADI
HLFNQLTLILQPSGKCLRWNENHSQRIPG
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|512615653|ref|NC_021499.1|:193256-195025 Pseudomonas resinovorans NBRC 106553 DNA, complete geonome
ATGGACATGGACAACCTGACGCTGCGCTATTTCGATGCGGAAATGCGCTACCTGCGCGAAGCCGGCCAGG
AATTCGCCGAGGCCTTTCCCGACCGCGCGGCGCAACTCAACCTGGATCGCCCGGGGGCGCGCGACCCTTA
TGTCGAGCGCCTGTTCGAAGGCTTCGCGTTTCTCATGGGGCGCCTGCGGGAAAAACTCGACGACGACTTG
CCGGAGCTGACCGAGGGGCTGGTCAGCCTGCTCTGGCCACACTACCTGCGCACCATCCCGTCGCTGTCGA
TCGTCGAGCTGGCGCCCGACCTGCAGCAGATGAAGCGCAGCGAGCGGATCGAGAAAGGGATGGAGGTGCT
GTCGCGGCCGGTGGGGCCGAAGCGCACTCGCTGCCGCTATACCACCACCCAGAACCTGACCCTGCAGCCC
CTGGCGGTGGAGTCGCTGCGCCTGGCCCATGAGCCCGACGGGCGTTCGCTGCTGCGCCTGCGCCTGGCCT
GCGGCCCGTTGACCGAATGGGCGCAGGTGGACCTCAGCCGGCTGCCCCTATACCTCAATGCCGACGCGCC
GGTGGCCAGCGCGCTGCACCTGGCGCTGACCCGTCAGACGCAGGCGCTCTACGTACGCCTGCCCGGCGAC
CCGGAACGTAGGCCGCTGGATGGCTACTTCGCGACCAAGGGCTTCGCCGAGGATGATCGTCTGTGGCCCA
AGGGCGACAGTGCCTTCAGCGGCTACCAGCTGCTGCTGGAGTACTTCAGCTTCCGCGAGAAATTCATGTT
CGTCACCCTGCACGGGCTCGAGCGACTGGTGGTGCCGGAGGGCGCGCCCTGGTTCGAGATCGAAGTGGTG
CTGGGCGAGGGTTGGCCACATGACTTCGAACCCCGCGCCGAGCATGTCCGCCTGCACGCGGTACCGGTGA
TCAACCTGTTCGAGCTGGAGGCCGACCCGCTGCGCCTGGACCCCCTCCAAGGCGACTACCTGCTGCGTCC
CATGCGCCTGCAGGACGGGCACACGGAAATCTATTCGGTGGACCAGGTGAGCGCCTCGAAGAATGCCGAG
CGCGTGGACTATGTGCCGTTCAGCAGTTTCCGCCACAAGGGCGGGATGCTGCGGGACGACGCCCCGGAAC
GCTACTTCCACACCCGCCTCAAGCGCGGCGCGAACGGCTTGCACGACACCTGGCTGATCCTCGGCGGCGA
GGGCTTCGATGTCGACCGCCTGGTGGCCGGCGAGAGCCTGTCCCTGCGCCTGACCGGCACCAACGGCCAG
CTGCCGCGCAAGGCCTTGCAGAGCACGCTGCTCGACACCCCGGTGCAGTCCACGCAGACCGGGCTGCGGG
TGCTCAACCTGTGCGCGCCGACCATGCCCTGCTATCCGCCGAGCCGTGATCGCTTCCACTGGCGGGTACT
CAGCCACCTGGGCTCGAACTTCCTGCCCATGCTGGACAACGCCGAGGTCTTGCGCGGAACCCTGGCGCTC
TACGACTGGACCGGCAGCGAACTGAACCGCCGCCGCCTGGAGGCCCTGGTCGATGTCCGCCACCACCTGA
TCCAGCGTTTCGAGAAGGGCTTCCTGCTGCGCGGCGTCGATATCGAGGTCACGCTGGACGCCAACGGCTT
CTCCGGCGAGGGCGACATCAGCCTGTTCGGCGAAATGCTCAACCGCTTCTTCGCCCTCTATGCCGATATC
CACCTGTTCAACCAGCTCACGCTGATCCTGCAACCCTCTGGTAAGTGCCTGCGATGGAACGAGAACCACA
GTCAGCGTATTCCCGGCTGA