SecReT6
Protein ID: 512615827
SecReT6 ID808
T6SS typei2
Gene symbol-
Locus tagPCA10_01740
StrainPseudomonas resinovorans NBRC 106553
Repliconchromosome [GenBank: NC_021499] [Browse all T6SS(s) in this replicon]
Location [Strand]195037..196083 [+]
Producthypothetical protein
NoteTssG
UniProt IDS6AQ50
KEGG IDpre:PCA10_01740
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.50E-83, Aligned region: 11..309
Protein Sequence: 348 a.a.     [Download]
>gi|512615827|ref|YP_008100511.1| hypothetical protein PCA10_01740 [Pseudomonas resinovorans NBRC 106553]
MLQALDGRSAEANLFRFCQLLEQALPGQPPLGSSARPSDDPVRFRPDPGMGFPAGELKAIETDDSRPFAP
ATVRTRLLGLYGVDSPLPTSYLDDIAQRREGHEALQAFLDIFNHRLFTQLYRIWRKYSYPATFEAGGTDA
TSQCLLGLIGLGIPGTADHVATPISRFLALLSVMRLPTRNAEGVTALVKLLAPNTRVSVTPHWPRRVVLA
QPAGLSAARPVSLSQGTPLGSVGLDANSQIQLTLFTEDRQEAQGWLPGARLHSDLLVLLRVYLGWRCTAR
LALCLPEHCLPHPVLGRAPVLLGMTGLLGLGGGRPPADSGTVTISLGRYRGLENNPEERETQHVAYRF
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|512615653|ref|NC_021499.1|:195037-196083 Pseudomonas resinovorans NBRC 106553 DNA, complete geonome
TTGCTGCAAGCCCTGGACGGGCGTTCGGCAGAGGCGAACCTGTTTCGCTTCTGCCAATTACTGGAGCAGG
CCCTGCCCGGGCAGCCTCCCCTGGGCAGCAGCGCCCGCCCGTCCGATGACCCGGTGCGCTTTCGCCCGGA
CCCCGGCATGGGGTTTCCCGCCGGCGAGCTGAAGGCCATCGAAACCGATGACAGCCGGCCCTTCGCGCCG
GCCACGGTGCGCACCCGCCTGCTGGGGCTCTACGGCGTGGATTCGCCGCTGCCCACCAGCTACCTGGACG
ACATCGCGCAACGCCGCGAGGGGCACGAGGCCCTGCAGGCCTTCCTCGATATCTTCAACCACCGGCTCTT
CACCCAGCTGTACCGTATCTGGCGCAAGTACTCCTACCCGGCGACCTTCGAAGCCGGCGGCACGGATGCG
ACGTCGCAGTGCCTGCTGGGGCTGATCGGCCTGGGTATCCCCGGCACCGCCGATCATGTCGCGACACCGA
TCTCGCGCTTCCTGGCACTGCTCAGTGTCATGCGCCTGCCCACCCGCAACGCCGAGGGTGTGACGGCGCT
GGTGAAGCTGCTGGCGCCCAACACCCGGGTGAGCGTCACGCCGCACTGGCCGCGACGGGTGGTGCTGGCG
CAGCCGGCTGGCCTGTCGGCGGCCCGCCCGGTGAGCCTGTCCCAGGGGACGCCGCTGGGCAGCGTCGGCC
TCGACGCCAACAGCCAGATCCAGCTGACCCTGTTCACCGAGGACCGCCAGGAGGCGCAGGGCTGGCTTCC
GGGTGCCCGCCTGCACAGCGACCTGCTGGTGCTGTTGCGGGTCTACCTCGGTTGGCGCTGTACCGCGCGT
CTGGCGTTGTGCCTGCCCGAACACTGCCTGCCACACCCCGTGCTTGGCCGTGCGCCGGTGCTGCTCGGCA
TGACCGGGCTGCTGGGGTTGGGTGGCGGCCGGCCCCCGGCCGATTCGGGCACCGTCACCATCAGCCTGGG
TCGTTACCGGGGCCTGGAGAACAATCCTGAGGAAAGAGAGACACAGCATGTCGCGTACCGTTTTTAA