SecReT6
Protein ID: 512615829
SecReT6 ID808
T6SS typei2
Gene symbol-
Locus tagPCA10_01760
StrainPseudomonas resinovorans NBRC 106553
Repliconchromosome [GenBank: NC_021499] [Browse all T6SS(s) in this replicon]
Location [Strand]196604..197041 [+]
Producthypothetical protein
NoteTssE
UniProt IDS6AL08
KEGG IDpre:PCA10_01760
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.20E-14, Aligned region: 30..117
Protein Sequence: 145 a.a.     [Download]
>gi|512615829|ref|YP_008100513.1| hypothetical protein PCA10_01760 [Pseudomonas resinovorans NBRC 106553]
MNDHVPSLYETLLQNFSGELELHRVREEDQPVLSVLDNLQRILNSRAGSLSHLPDYGLPDMGQVLQGLPA
AAHGLIAVMTHTLLKYEPRLAELKVLLLPQSQPGQLEYSLDLRLKSGEQATFGTTLAPAGKVLVRHLKRQ
QYLSP
 
Nucleotide Sequence: 438 bp     [Download]
>gi|512615653|ref|NC_021499.1|:196604-197041 Pseudomonas resinovorans NBRC 106553 DNA, complete geonome
ATGAACGACCACGTCCCATCGCTCTACGAAACGCTGCTGCAGAACTTCAGCGGGGAGCTGGAGCTGCACC
GGGTGCGGGAGGAGGATCAGCCCGTTCTCTCGGTACTCGACAACCTCCAGCGCATTCTCAATAGCCGCGC
CGGCTCCCTCAGTCACCTGCCCGACTACGGCTTGCCGGACATGGGCCAGGTGCTTCAGGGCCTGCCGGCG
GCCGCCCATGGCCTGATCGCCGTCATGACCCACACGCTGCTCAAGTATGAGCCGCGACTGGCGGAACTGA
AGGTCCTGCTGCTGCCCCAGTCGCAGCCGGGGCAACTGGAATACAGCCTCGATCTGCGCCTGAAGAGCGG
CGAGCAAGCGACCTTCGGCACCACCCTGGCGCCGGCGGGCAAAGTGCTGGTTCGTCACCTCAAGCGGCAG
CAATACCTGTCGCCGTGA