SecReT6
Protein ID: 512615830
SecReT6 ID808
T6SS typei2
Gene symbol-
Locus tagPCA10_01770
StrainPseudomonas resinovorans NBRC 106553
Repliconchromosome [GenBank: NC_021499] [Browse all T6SS(s) in this replicon]
Location [Strand]197071..198210 [+]
Producthypothetical protein
NoteTssA
UniProt IDS6BA15
KEGG IDpre:PCA10_01770
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-17, Aligned region: 34..94
OmpA [PF00691], Evalue: 8.50E-17, Aligned region: 265..361
Protein Sequence: 379 a.a.     [Download]
>gi|512615830|ref|YP_008100514.1| hypothetical protein PCA10_01770 [Pseudomonas resinovorans NBRC 106553]
MNGRAGNESPDRGEQAALYAEMAKLNHPARPDVDWPMVEQWCRELLRSNGGDLQVAVFLALALTHRYGLP
GLVEGMTVLRRLLTGPLDGVWPRKTHERSDLLAWLAAQLQFLLRGLEIGERDAPLLRSLEAELACVQEVL
NQHRLPALAAIQALNQQVTRLVGRLGGQGIPMLVGARSHGSVPPENPLQLVVSLPGHAPVAPVLYVEAVP
APMPVRRRSHAALWSLAGVLAALLLGVLAWNYWLLSREEVRAAAAEPVRLASVQLFDPASTVMKPDSTKV
LINALANVKAQPGWLIVIAGHTDATGDEQRNLSLSRQRAEAVRDWMKSMGDVPDDCFAVQGHGSSQPIAD
NATEAGRAANRRVDISLVQALGTCQVGPA
 
Nucleotide Sequence: 1140 bp     [Download]
>gi|512615653|ref|NC_021499.1|:197071-198210 Pseudomonas resinovorans NBRC 106553 DNA, complete geonome
ATGAATGGACGAGCCGGGAACGAATCGCCGGATCGCGGCGAGCAGGCCGCGCTGTACGCCGAAATGGCCA
AGCTGAACCATCCGGCCCGCCCGGATGTGGACTGGCCCATGGTCGAGCAGTGGTGCCGGGAATTGCTGCG
CAGCAATGGCGGCGACCTGCAGGTAGCCGTCTTTCTGGCGTTGGCGCTGACCCACCGTTACGGGTTGCCG
GGCCTGGTCGAAGGCATGACCGTGCTGCGGCGATTGCTGACCGGGCCCCTTGATGGCGTATGGCCCCGCA
AGACGCACGAACGCTCGGACCTCCTCGCCTGGCTGGCCGCGCAACTCCAGTTTCTGCTGCGCGGCCTGGA
GATCGGCGAACGGGACGCACCATTATTGCGGAGCCTGGAGGCGGAGCTGGCTTGCGTACAGGAAGTCCTG
AACCAGCACCGGCTACCGGCTTTGGCGGCGATACAGGCCTTGAACCAGCAGGTCACAAGGCTTGTCGGTC
GCTTGGGCGGGCAGGGGATTCCGATGCTTGTGGGCGCCCGTTCGCACGGGAGCGTGCCACCCGAGAACCC
GTTGCAGCTGGTGGTCTCGCTTCCAGGACACGCCCCGGTTGCACCGGTGCTGTATGTGGAGGCCGTTCCC
GCTCCGATGCCGGTCCGTCGCCGGAGCCACGCCGCGCTCTGGTCGTTGGCGGGAGTTCTCGCCGCACTGC
TACTGGGCGTGCTGGCCTGGAACTACTGGTTGCTCTCGCGGGAAGAGGTCCGCGCGGCGGCGGCCGAGCC
GGTGCGGCTGGCCAGCGTGCAATTGTTCGACCCCGCCAGTACGGTGATGAAGCCGGACTCGACCAAGGTG
CTGATCAATGCCCTGGCGAACGTCAAGGCGCAGCCCGGCTGGCTGATCGTCATTGCCGGGCACACCGACG
CCACGGGCGACGAACAGCGCAACCTGAGTCTGTCGAGGCAGCGGGCCGAGGCGGTTCGCGACTGGATGAA
AAGCATGGGCGATGTGCCCGATGACTGCTTCGCCGTCCAGGGCCACGGATCGAGTCAGCCCATTGCGGAC
AACGCCACCGAGGCGGGCCGTGCGGCCAACCGACGTGTCGACATCAGCCTGGTGCAGGCGTTGGGCACCT
GCCAGGTGGGGCCGGCCTGA