SecReT6
Protein ID: 512648098
SecReT6 ID809
T6SS typei3
Gene symbol-
Locus tagH650_00755
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]18222..18728 [+]
Producthypothetical protein
NoteTssJ
UniProt IDR9VFK1
KEGG IDenr:H650_00755
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.70E-32, Aligned region: 20..159
Protein Sequence: 168 a.a.     [Download]
>gi|512648098|ref|YP_008106007.1| hypothetical protein H650_00755 [Enterobacter sp. R4-368]
MNNNSVVRQISLVFFFVLATLASGCGSSSHSVPTSYNLQFRAHPQINESAPLKVRVLLLKSDATFMSADF
WSLQNNADSVLGANLLNSDEFFLMPGQLSKTLSGKSAPDARYIGVMAEYQALDGKKWRMSLPLPVQGETH
FYEFWKSSSDELEANIFLDVNGIRVISK
 
Nucleotide Sequence: 507 bp     [Download]
>gi|512647881|ref|NC_021500.1|:18222-18728 Enterobacter sp. R4-368, complete genome
ATGAATAATAATTCGGTTGTACGCCAGATTAGCCTGGTGTTTTTCTTTGTGCTGGCCACCCTGGCCAGCG
GTTGTGGCTCCTCTTCACACAGCGTACCTACCAGCTATAACCTTCAGTTCAGGGCTCATCCGCAAATCAA
TGAGTCCGCTCCCCTTAAAGTCAGGGTGTTGCTGTTGAAATCGGACGCGACATTTATGTCCGCCGATTTC
TGGTCGCTGCAAAACAACGCAGATAGCGTACTTGGCGCCAACCTGCTGAACAGTGATGAATTTTTCCTGA
TGCCCGGCCAGTTGTCGAAAACGCTGAGCGGTAAAAGCGCGCCCGACGCGCGTTACATCGGCGTGATGGC
GGAGTATCAGGCGCTGGATGGCAAAAAATGGCGGATGTCCTTACCGCTCCCGGTGCAGGGAGAGACGCAC
TTCTACGAATTCTGGAAATCGTCGTCAGACGAACTGGAAGCCAACATCTTCCTCGACGTCAATGGCATCC
GTGTGATTTCCAAATAG