SecReT6
Protein ID: 512648099
SecReT6 ID809
T6SS typei3
Gene symbol-
Locus tagH650_00760
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]18753..20096 [+]
Producthypothetical protein
NoteTssK
UniProt IDR9VK06
KEGG IDenr:H650_00760
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.60E-135, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|512648099|ref|YP_008106008.1| hypothetical protein H650_00760 [Enterobacter sp. R4-368]
MNKAEKVVWTEGMFLRPHHFQRAESYLQHHIREWGTLQRPYLWGYLDIELDDAMLRQGCIALSYASGLLP
DGTFFSFHDARQAPTPLAIPDNINNERVVLALPARRGGRDEVIFSEEKDSLARYVTWESEVDDDNAMSVG
PAAVQFGRLRLKLMLEKDLSAEWTAIGVAHVVEKRNDNHVRIDSRYIPPMLNAVNNPAIYAIINDLQSLL
MQRSQQIGQRLRQPGRFNTSEMVEFTLLALINHHVGQVSHLKTLPMIHPEELWRSWLAFATELTTWTASR
SPEETLPVYDHDDLAGCFGKLQLMLRNGLSLVMEEHAIQLPLTERTHGLNIATLPTTTMAREFGFVLAVK
ASVPGEILQTHFPAQMKVAPVTKIRDLVQLQLPGMKLRTMPVAPPQIPWHAGYNYFELEKGGELWNEMEK
SGAFALHLAGEFPGLDMEFWAIRSPTE
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|512647881|ref|NC_021500.1|:18753-20096 Enterobacter sp. R4-368, complete genome
ATGAACAAAGCAGAAAAGGTCGTGTGGACCGAAGGTATGTTTCTGCGCCCTCATCACTTTCAGCGAGCGG
AAAGCTATCTGCAACACCATATTCGCGAGTGGGGGACACTGCAGCGCCCGTATCTTTGGGGCTACCTTGA
TATCGAGCTCGACGATGCCATGCTGCGCCAGGGCTGTATTGCCCTGAGTTATGCCAGCGGTTTACTGCCG
GATGGCACGTTCTTCTCATTCCACGATGCTCGCCAGGCGCCCACACCGCTGGCTATCCCTGACAACATCA
ACAATGAGCGCGTGGTGCTGGCGCTGCCTGCCCGTCGCGGCGGGCGTGATGAGGTGATCTTTAGCGAAGA
GAAAGATTCGCTGGCGCGTTATGTCACCTGGGAAAGCGAAGTCGATGACGATAACGCCATGTCCGTCGGG
CCGGCGGCGGTGCAGTTTGGCCGTCTGCGTCTGAAACTGATGCTGGAAAAAGATCTCTCGGCAGAGTGGA
CGGCGATCGGTGTCGCGCATGTTGTAGAAAAACGTAACGATAACCACGTTCGAATTGATAGCCGTTATAT
TCCGCCGATGCTGAATGCGGTTAACAACCCGGCGATTTACGCCATTATCAACGATCTGCAAAGTTTGCTG
ATGCAGCGTAGCCAGCAGATTGGCCAGCGTCTGCGCCAGCCGGGGCGTTTTAATACCTCTGAAATGGTGG
AATTCACGCTGCTGGCCTTGATTAACCACCATGTCGGCCAGGTTTCCCATCTGAAAACGCTGCCGATGAT
CCACCCGGAAGAGTTGTGGCGCAGCTGGCTGGCGTTTGCCACCGAGCTGACCACCTGGACCGCGTCACGC
TCGCCGGAAGAGACGCTGCCGGTTTACGACCATGACGATCTGGCCGGCTGTTTTGGCAAGTTACAACTGA
TGCTGCGCAATGGGTTGTCTCTGGTGATGGAAGAGCACGCCATCCAGTTGCCGCTCACCGAACGCACGCA
CGGGTTGAATATCGCCACGTTGCCGACCACCACCATGGCGCGCGAGTTTGGTTTCGTGCTGGCAGTGAAA
GCCAGTGTCCCGGGCGAAATCCTGCAAACCCATTTCCCGGCCCAGATGAAAGTCGCGCCGGTCACCAAAA
TCCGCGACCTGGTGCAGTTGCAACTGCCGGGTATGAAGTTGCGCACCATGCCGGTCGCGCCGCCGCAAAT
TCCGTGGCATGCCGGTTACAACTATTTCGAACTGGAAAAGGGCGGCGAGCTGTGGAACGAAATGGAAAAA
TCGGGGGCTTTCGCGCTGCATCTGGCAGGTGAATTCCCGGGTCTTGATATGGAGTTTTGGGCCATCCGTA
GCCCGACTGAATAA