SecReT6
Protein ID: 512648100
SecReT6 ID809
T6SS typei3
Gene symbol-
Locus tagH650_00765
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]20114..21352 [+]
Producthypothetical protein
NoteTssL
UniProt IDR9VI37
KEGG IDenr:H650_00765
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.20E-70, Aligned region: 20..225
DUF2077 [PF09850], Evalue: 2.20E-70, Aligned region: 367..389
OmpA [PF00691], Evalue: 4.70E-15, Aligned region: 290..388
Protein Sequence: 412 a.a.     [Download]
>gi|512648100|ref|YP_008106009.1| hypothetical protein H650_00765 [Enterobacter sp. R4-368]
MQEQQASGSDAALAGASGNNPLVAAANPLLNAIPQIRYSVSHDDQSGLRQHLIDEIRRFEVRCQQSGLAY
EVIVGARYCLCTALDEAAALTPWGSRGVWSGSGLLVTFHNETWGGEKFFQLLARLSQNPREHIALLELIN
FCLLLGFEGRYRVMDNGRTQLETIKQRLWQMIRGVRGNYPPPLSPHPEDQPVMRKLWRPVIPLWACVGLA
GFLACLFYIVLNWRLGDSTNPVLAKIYQTQLPEAAIEQPVQNVQPVLNLRAFLRPEIQAGLVAVRDEADR
SVVTLKGDGLFASGSTVARESYEPVIDRVAQAMNNVSGKILVVGFSDNVPIRSARFASNYELSLERARSV
QSLLQKHLSQPARVKAEGRGEMNPIAPNNSAENRARNRRVEITLLVSPGNTAAELNGLPQGN
 
Nucleotide Sequence: 1239 bp     [Download]
>gi|512647881|ref|NC_021500.1|:20114-21352 Enterobacter sp. R4-368, complete genome
ATGCAGGAACAACAAGCCTCCGGCAGCGATGCCGCTCTGGCAGGAGCAAGTGGCAACAATCCTTTGGTCG
CGGCCGCCAACCCGCTACTTAACGCGATACCGCAGATCCGCTATTCCGTTTCTCATGATGATCAAAGCGG
TCTGCGCCAGCACCTGATTGATGAAATTCGCCGTTTTGAAGTGCGCTGCCAGCAATCCGGGCTGGCCTAC
GAAGTGATCGTCGGCGCCCGTTACTGTTTATGCACCGCGCTGGATGAAGCGGCGGCGCTCACGCCGTGGG
GCAGCCGTGGCGTCTGGTCCGGTAGCGGTCTGCTGGTGACGTTCCACAACGAAACCTGGGGCGGGGAGAA
ATTCTTCCAGCTGCTGGCGCGCTTGTCGCAAAACCCGCGCGAGCATATCGCGCTGCTGGAGCTGATCAAC
TTCTGCCTGTTACTCGGTTTTGAAGGACGTTACCGGGTGATGGACAACGGCCGCACGCAACTGGAAACCA
TCAAACAGCGCTTGTGGCAGATGATTCGCGGTGTGCGTGGCAACTATCCGCCGCCGCTGTCGCCGCACCC
GGAAGATCAACCGGTCATGCGCAAATTGTGGCGGCCGGTTATTCCGCTGTGGGCGTGTGTCGGGCTGGCG
GGATTTCTCGCCTGCCTGTTCTATATCGTGCTCAACTGGCGTCTGGGTGACAGCACCAACCCGGTGCTGG
CGAAAATTTACCAAACCCAGTTGCCGGAAGCGGCCATTGAGCAGCCGGTACAAAACGTGCAGCCGGTACT
TAACCTGCGCGCGTTTCTGCGCCCGGAAATTCAGGCAGGCCTGGTGGCGGTGCGCGATGAAGCCGATCGC
AGCGTGGTAACACTCAAAGGCGATGGGTTGTTTGCCTCGGGATCGACGGTGGCACGCGAAAGCTATGAAC
CGGTTATCGATCGTGTTGCGCAGGCGATGAATAACGTCAGCGGCAAAATTCTGGTGGTGGGTTTCAGTGA
CAACGTGCCGATCCGCAGTGCGCGTTTCGCCTCGAACTACGAGCTGTCGCTTGAGCGCGCGCGTTCTGTG
CAGTCGCTGCTGCAAAAACACCTGTCGCAACCGGCGCGTGTGAAAGCGGAAGGACGAGGGGAGATGAACC
CGATAGCGCCGAACAACTCGGCTGAAAACCGCGCCCGTAACCGCCGCGTAGAGATTACTTTGCTGGTGTC
GCCGGGAAATACGGCCGCCGAGCTGAACGGATTGCCGCAAGGAAACTAA