SecReT6
Protein ID: 512648103
SecReT6 ID809
T6SS typei3
Gene symbol-
Locus tagH650_00780
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]25708..26721 [+]
Producthypothetical protein
NoteTssA
UniProt IDR9VFK6
KEGG IDenr:H650_00780
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.60E-20, Aligned region: 52..111
Protein Sequence: 337 a.a.     [Download]
>gi|512648103|ref|YP_008106012.1| hypothetical protein H650_00780 [Enterobacter sp. R4-368]
MTIESLLAPVSPEQPCGENLEYDADFQAMEQASLGKAEQQFGSTIIPAEPADWTRVEKLATGLLARTKDI
RVMMALTHAWTRRRGLEGYADGLMLLGQALALYWDQLWPSLTDGGEFDPFYRINALAGLSDKSSLTTTLR
QSTLLRSNGDELNVRDAQALLDGSKTECAGYPGGRVRLIDELTRGGQPGIEAICQIEGRLQTIRTWLLEQ
LGESGVPEMEQLLKTVGLIAGVSRANRTEEQQATEQTAPAESAPQAVVATPLAAHTDWRTAQVTTRADAQ
LMLEKVKQYFTQHEPSHPAPLMIDRVQRLIELDFMEIIRDLAPDGVNQLQNIFGRQD
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|512647881|ref|NC_021500.1|:25708-26721 Enterobacter sp. R4-368, complete genome
ATGACTATAGAATCGTTACTCGCTCCGGTCAGCCCGGAGCAGCCTTGCGGTGAGAATCTGGAGTACGACG
CCGATTTCCAGGCGATGGAGCAGGCGAGCCTCGGCAAAGCCGAGCAGCAGTTTGGCAGCACCATTATTCC
CGCCGAACCGGCAGACTGGACGCGGGTGGAAAAACTGGCCACCGGGCTGCTGGCGCGCACCAAAGATATC
CGCGTAATGATGGCGTTAACCCATGCGTGGACTCGACGTCGCGGGCTGGAAGGCTATGCTGATGGTTTAA
TGCTGTTAGGCCAGGCGCTGGCGCTGTACTGGGATCAACTCTGGCCTTCGCTGACTGACGGTGGTGAATT
CGACCCGTTTTATCGCATTAATGCGCTGGCGGGGTTAAGCGATAAATCTTCGCTGACCACCACGCTGCGC
CAGTCGACGCTGCTGCGCAGCAACGGTGATGAGCTAAACGTGCGCGACGCGCAGGCGTTGCTTGACGGCA
GCAAAACGGAATGTGCAGGCTATCCTGGCGGTCGGGTGCGTCTGATTGATGAACTCACGCGCGGCGGTCA
GCCTGGCATTGAGGCTATCTGCCAAATCGAAGGGCGTCTGCAAACGATCCGTACATGGTTGCTCGAACAA
CTGGGCGAAAGCGGGGTGCCGGAAATGGAACAGTTACTCAAAACGGTCGGGTTAATCGCCGGCGTCAGCC
GCGCTAACCGCACGGAAGAGCAACAGGCGACAGAACAAACGGCACCTGCGGAGAGCGCACCGCAAGCGGT
TGTCGCGACACCGCTTGCGGCGCATACCGACTGGCGAACCGCACAGGTTACCACGCGTGCCGATGCGCAA
CTGATGCTGGAAAAAGTGAAGCAATATTTCACCCAGCACGAGCCGAGCCACCCCGCGCCGTTGATGATTG
ACCGCGTACAGCGGCTAATCGAACTGGACTTTATGGAGATTATTCGCGATCTGGCGCCCGATGGCGTGAA
TCAACTGCAAAACATCTTTGGGCGTCAGGACTGA