SecReT6
Protein ID: 512648104
SecReT6 ID809
T6SS typei3
Gene symbol-
Locus tagH650_00785
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]26796..27320 [+]
Producthypothetical protein
NoteTssB
UniProt IDR9VK09
KEGG IDenr:H650_00785
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.40E-61, Aligned region: 11..162
Protein Sequence: 174 a.a.     [Download]
>gi|512648104|ref|YP_008106013.1| hypothetical protein H650_00785 [Enterobacter sp. R4-368] [TssB]
MAISNSGQKFIARNRAPRVQIEYDVEVYGAERKIQLPFVMGVMADLVGKPVENLPSIEDRKFLEIDVDNF
DERMKALKPRVAFNVDNTLTGEGRLNVDLTFDSMDDFLPDAVARKVEPLNKLLEARTQLSNLLTYMDGKN
GAEELIAKVLQDPTLLKSLSQLPNSEDSAQGKEE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|512647881|ref|NC_021500.1|:26796-27320 Enterobacter sp. R4-368, complete sequence [TssB]
ATGGCAATAAGTAACAGTGGTCAGAAATTTATCGCCCGCAACCGTGCCCCCCGCGTACAGATTGAGTACG
ACGTGGAAGTGTACGGCGCGGAGCGCAAAATCCAGCTTCCGTTTGTGATGGGCGTAATGGCGGATCTGGT
AGGGAAACCGGTGGAGAACTTACCTTCTATTGAGGATCGTAAATTCCTCGAAATCGACGTCGACAACTTC
GACGAACGCATGAAAGCGCTGAAACCGCGCGTGGCGTTCAACGTCGACAACACGCTGACCGGCGAAGGTC
GTCTGAACGTCGATTTAACTTTCGACAGCATGGATGACTTCCTGCCGGACGCGGTGGCGCGCAAAGTTGA
GCCGCTGAACAAGCTGCTGGAAGCGCGTACTCAGCTCTCCAACCTGCTGACCTACATGGACGGCAAAAAC
GGCGCGGAAGAGTTGATTGCCAAAGTGTTGCAGGATCCAACCCTGCTGAAATCGCTCAGCCAGTTACCGA
ACAGTGAAGACAGTGCGCAAGGTAAAGAGGAGTAA