SecReT6
Protein ID: 512648105
SecReT6 ID809
T6SS typei3
Gene symbol-
Locus tagH650_00790
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]27324..28826 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDR9VI40
KEGG IDenr:H650_00790
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-196, Aligned region: 67..493
Protein Sequence: 500 a.a.     [Download]
>gi|512648105|ref|YP_008106014.1| EvpB family type VI secretion protein [Enterobacter sp. R4-368]
MSNPSQQQELQQGAQAFSQDEFSALLSKEFRPKTDQARSAVESAVKTLAQQALENTVTFSSDTYRTIQNL
IAGIDEKLSQQINQIIHHEDFQKLESAWRGLSHLVNNTETDEMLKIRFMSISKQELGRNLKRYKGVGWDQ
SPLFKKIYEEEYGQFGGEPFGCLVGDYYFDHSPQDVELLGEMARIGAAAHCPFITGTAPSVMQMESWQEL
ANPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEETDGANHNNYSWA
NAAYAMATNINRSFKEYGWCTSIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGF
MPLIHRKNSDFAAFIGAQSLQKPMEYHDADATANARLASRLPYLFACCRFAHYLKCIVRDKIGSFRERDE
MERWLNDWVMNYVDGDPANSSQETKARKPLAAAEVQVQEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVS
KLPSLKTKEA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|512647881|ref|NC_021500.1|:27324-28826 Enterobacter sp. R4-368, complete genome
ATGAGCAACCCTTCTCAACAGCAAGAATTGCAGCAGGGCGCACAGGCCTTCAGCCAGGATGAATTCAGCG
CGCTGCTCAGCAAAGAGTTCCGTCCGAAAACGGATCAGGCGCGTTCAGCGGTAGAAAGCGCGGTGAAAAC
GCTGGCGCAACAGGCGCTGGAAAACACCGTCACCTTCTCCAGCGATACCTACCGCACCATTCAGAACCTG
ATTGCCGGGATTGATGAAAAGCTGTCGCAGCAGATTAACCAGATCATCCACCACGAAGATTTCCAGAAAC
TGGAAAGCGCGTGGCGCGGTCTGAGTCATCTGGTGAACAACACCGAAACCGACGAGATGCTGAAAATTCG
CTTTATGAGCATCTCCAAGCAGGAGCTGGGCCGTAACCTGAAACGCTACAAAGGCGTGGGCTGGGACCAG
AGCCCGCTGTTCAAAAAAATCTATGAAGAAGAGTATGGACAGTTCGGTGGCGAACCGTTTGGCTGCCTGG
TTGGCGACTACTACTTCGACCACAGCCCGCAGGATGTCGAACTGCTGGGCGAAATGGCGCGCATCGGCGC
GGCGGCACACTGCCCGTTCATTACCGGTACTGCGCCAAGCGTGATGCAGATGGAGTCCTGGCAGGAGCTG
GCGAACCCGCGCGATCTGACGAAAATCTTCCAGAACACCGAATACGCCGCCTGGCGTTCACTGCGTGAAT
CTGAAGATGCCCGTTACCTTGGCCTGGTCATGCCGCGCTTCCTGTCGCGTCTGCCGTACGGTATCCGCAC
CAACCCGGTTGACAGCTTCGATTTCGAAGAAGAGACCGATGGCGCGAACCACAACAACTATTCGTGGGCG
AACGCGGCCTACGCCATGGCGACCAACATCAACCGTTCCTTCAAAGAGTACGGCTGGTGTACCTCGATTC
GCGGTGTGGAATCCGGTGGTGCGGTAGAAAACCTGCCATGCCATACCTTCCCGAGCGATGACGGCGGCGT
GGACATGAAGTGCCCGACCGAGATCGCCATCAGCGACCGTCGCGAAGCAGAACTGGCGAAAAACGGCTTT
ATGCCGCTTATCCATCGTAAAAACTCCGACTTCGCTGCCTTTATTGGCGCACAGTCGCTGCAAAAACCGA
TGGAGTACCACGACGCCGACGCGACCGCTAACGCACGTCTCGCTTCCCGTCTGCCGTATCTGTTCGCCTG
CTGCCGTTTTGCGCACTACCTGAAGTGCATTGTGCGCGACAAAATCGGCTCATTCCGCGAGCGTGACGAA
ATGGAACGCTGGCTGAACGACTGGGTGATGAACTACGTCGACGGCGACCCGGCGAACTCCTCGCAGGAAA
CCAAAGCGCGTAAACCGCTGGCTGCGGCAGAAGTGCAGGTGCAGGAAATCGAAGATAACCCTGGTTACTA
CGCGGCGAAATTCTTCCTGCGTCCGCACTACCAGCTGGAAGGTCTGACCGTTTCTCTGCGTCTGGTATCC
AAACTGCCGTCGCTGAAAACCAAAGAGGCGTAA