SecReT6
Protein ID: 512648111
SecReT6 ID809
T6SS typei3
Gene symbol-
Locus tagH650_00820
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]32935..34740 [+]
Productsignal peptide protein
NoteFha
UniProt IDR9VFZ2
KEGG IDenr:H650_00820
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.50E-08, Aligned region: 27..93
Protein Sequence: 601 a.a.     [Download]
>gi|512648111|ref|YP_008106020.1| signal peptide protein [Enterobacter sp. R4-368]
MRFTIITSKPGHQPPQSSCDFYPPGGTIGRGTDNNLVLPDNDRSISRLQAIVHIAGNGECRVTNRGNVTR
VVLNDIPLERGRQVELQDGDILGIDEYRIEVTDLIQDTRPVTRMAEEMYPKPAQPQVAKPAPAPAQKNAP
EGAPASVPTEIWDSLMQEFSISDSISSSRAKPQEAQNLNPFAAPKGPERNPEDPLSLLNNNEPLVTPKSL
ASDQLFNDEQLFKNDSIFNDSTPSALVPPVEPTQKSHTPDSDELDPLALFGGSGSTKQTRSDDPLGLLSG
AVPLAHADELAAQKPAEPQPIITDLNTPEPPPTAQPIITELRPEDLSSTPLFADDAPLSAPEEVQEQQDY
AGITLPTPQAVQRSAAQTPKGRLRIDPVQSNGTKSTPSVSTGDSGDVLKGELLDALLEGMGLSDMQPVPQ
FDKENMRQFGQMLSMFSQGTVALLSSRSILKRGVKADMTMVLDDANNPFKLLPSGKTVLMQMFGTRMPGF
MPPKKSVRDALIDLQAHQLGMISGIRAIIAAMLQQFNPEQLEDDAKRDGATARLGVLSNRKAALWDYYVR
TYAQTAGEIDDDFHTLFGEAFLHAYDMEVNQYKDSQSGSEE
 
Nucleotide Sequence: 1806 bp     [Download]
>gi|512647881|ref|NC_021500.1|:32935-34740 Enterobacter sp. R4-368, complete genome
ATGCGATTCACTATTATTACCAGTAAACCCGGTCATCAGCCGCCACAAAGTAGCTGCGACTTTTATCCCC
CGGGCGGCACCATTGGCCGCGGCACGGACAACAATCTGGTGCTGCCGGACAACGACCGTTCCATTTCACG
TTTGCAGGCGATTGTCCATATCGCCGGCAATGGCGAGTGCCGCGTCACCAACCGTGGCAACGTGACCCGC
GTCGTACTGAATGACATCCCCCTTGAACGTGGGCGTCAGGTTGAGCTGCAGGATGGCGATATTCTTGGCA
TCGATGAGTACCGTATTGAAGTCACCGATCTGATCCAGGATACCCGTCCCGTCACCCGTATGGCGGAAGA
AATGTATCCGAAGCCAGCGCAGCCGCAGGTGGCGAAACCGGCACCTGCTCCGGCGCAGAAAAACGCGCCA
GAAGGCGCACCGGCGTCCGTGCCGACGGAAATCTGGGACAGCCTGATGCAGGAGTTTTCCATCTCCGACA
GCATCTCCAGCAGCCGTGCGAAACCGCAGGAAGCGCAAAATCTTAACCCGTTCGCCGCGCCGAAAGGGCC
GGAGCGCAACCCGGAAGATCCGCTGTCGCTGCTCAATAACAATGAACCGCTGGTGACGCCGAAATCGCTG
GCCTCGGATCAGCTGTTTAACGACGAACAGTTGTTTAAAAACGACAGCATCTTCAACGATTCCACGCCTT
CTGCGCTGGTGCCGCCGGTTGAACCGACACAAAAATCGCACACGCCGGATAGCGACGAGCTCGATCCGCT
GGCGCTGTTTGGCGGTAGCGGTAGCACGAAGCAAACCCGCAGCGACGATCCGCTTGGCCTGCTGAGCGGC
GCGGTGCCGCTGGCGCATGCCGATGAACTGGCGGCGCAGAAACCGGCTGAACCGCAGCCGATCATTACCG
ATCTCAACACGCCGGAACCGCCGCCAACCGCTCAGCCGATTATTACCGAGCTGCGCCCGGAAGATTTAAG
TTCGACGCCGCTATTTGCCGACGACGCGCCGCTCTCCGCGCCGGAAGAGGTGCAGGAGCAGCAGGATTAC
GCTGGTATCACGCTGCCAACACCGCAGGCGGTGCAGCGCAGCGCGGCGCAAACGCCGAAAGGGCGTCTGC
GTATCGATCCGGTTCAGAGCAATGGCACGAAGAGCACGCCCTCAGTCAGCACCGGCGACAGCGGTGATGT
GCTGAAGGGTGAGCTGCTTGATGCGCTGCTTGAAGGCATGGGACTGAGCGACATGCAGCCGGTGCCGCAG
TTCGATAAAGAAAACATGCGCCAGTTCGGTCAGATGCTGAGCATGTTCTCGCAGGGCACGGTTGCGCTGT
TGTCGTCGCGTTCTATTCTGAAACGCGGTGTAAAAGCGGACATGACCATGGTGCTGGATGACGCCAACAA
CCCGTTCAAACTGCTGCCGTCGGGTAAAACCGTATTAATGCAGATGTTCGGCACGCGTATGCCTGGTTTT
ATGCCGCCGAAAAAATCGGTGCGTGACGCGCTGATCGATTTACAGGCGCACCAGCTGGGGATGATCTCCG
GTATTCGCGCCATTATCGCCGCCATGTTGCAGCAGTTTAATCCGGAGCAACTGGAAGATGACGCCAAACG
CGACGGCGCAACCGCGCGGCTTGGCGTGCTCTCCAACCGTAAAGCCGCGTTATGGGATTACTACGTTCGT
ACTTACGCCCAGACGGCCGGTGAGATTGACGATGACTTCCACACCCTGTTTGGCGAAGCGTTCCTCCACG
CTTACGACATGGAAGTCAACCAGTACAAAGACTCACAAAGCGGATCGGAAGAATGA