SecReT6
Protein ID: 512648114
SecReT6 ID809
T6SS typei3
Gene symbol-
Locus tagH650_00835
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]36551..37363 [+]
Producthypothetical protein
NoteTagJ
UniProt IDR9VK19
KEGG IDenr:H650_00835
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.50E-42, Aligned region: 142..263
TPR_20 [PF14561], Evalue: 0.0011, Aligned region: 15..55
TPR_20 [PF14561], Evalue: 0.0011, Aligned region: 105..129
Protein Sequence: 270 a.a.     [Download]
>gi|512648114|ref|YP_008106023.1| hypothetical protein H650_00835 [Enterobacter sp. R4-368]
MNTLFQQLAGESLRESLAQLESRIRTQPGDADLRAAFAQLLCLDGNWSRALAQLKSWQALKPQAQPTVTL
LEQAIEGERQRADVMAGRARPVTPDQQWPWLASMVSALEPEAANASADREAALEMADANPGQLTTQDGQT
LNFDWLMDGDCRFGPVCEAIVNGRYFWLPFSAISAMQFQPPASVTDLVWRHTLVRLQDGSEQVCQIPARY
PLDANADDRFKLCRVTEWQPLPGDAPHYIGQGQKVWLNDSAEYSLLDLATVSFNVEAADE
 
Nucleotide Sequence: 813 bp     [Download]
>gi|512647881|ref|NC_021500.1|:36551-37363 Enterobacter sp. R4-368, complete genome
ATGAACACGTTGTTTCAACAACTGGCGGGCGAATCGTTGCGGGAAAGCCTGGCGCAGCTCGAAAGCCGTA
TCCGCACGCAGCCGGGCGACGCCGATCTGCGCGCCGCGTTCGCCCAACTGTTGTGCCTTGATGGCAACTG
GTCGCGCGCGCTGGCGCAGTTAAAAAGCTGGCAGGCGTTAAAACCGCAGGCACAGCCAACCGTTACGCTG
CTGGAACAAGCCATTGAAGGCGAACGCCAGCGTGCGGACGTGATGGCCGGTCGCGCGCGTCCGGTTACGC
CGGATCAACAATGGCCGTGGCTGGCATCAATGGTCAGCGCGCTGGAGCCGGAAGCGGCGAATGCCAGCGC
AGATCGTGAAGCCGCGCTGGAAATGGCCGACGCTAACCCCGGGCAGTTGACGACGCAGGACGGTCAAACG
CTGAACTTTGACTGGCTGATGGATGGCGATTGCCGCTTTGGCCCGGTCTGCGAAGCTATCGTCAATGGCC
GTTATTTCTGGCTGCCGTTCAGCGCCATTTCCGCCATGCAGTTCCAGCCCCCGGCCAGCGTCACCGATTT
AGTATGGCGTCACACGCTGGTGCGCTTGCAGGATGGCAGCGAACAGGTGTGCCAGATCCCGGCGCGCTAT
CCGCTGGATGCGAATGCCGATGACCGCTTTAAGCTGTGTCGCGTCACCGAATGGCAGCCGTTGCCAGGCG
ATGCGCCGCACTATATCGGGCAGGGGCAAAAAGTGTGGCTTAACGACAGCGCCGAATATTCGCTGCTCGA
TCTCGCCACCGTCAGCTTTAACGTGGAAGCCGCAGATGAGTAA