SecReT6
Protein ID: 512648115
SecReT6 ID809
T6SS typei3
Gene symbol-
Locus tagH650_00840
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]37356..37925 [+]
Producthypothetical protein
NoteTssE
UniProt IDR9VI48
KEGG IDenr:H650_00840
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.90E-20, Aligned region: 57..168
Protein Sequence: 189 a.a.     [Download]
>gi|512648115|ref|YP_008106024.1| hypothetical protein H650_00840 [Enterobacter sp. R4-368]
MSNSAHDEESDLLRSGWRSRRGKETVGARDKMQPSLLDRLTDDAPDKVQEPVNNNLVSHSALRRHVLRDL
QWLFNTINNEAQQDLSGFDQVRRSVVNFGVSPLAGKRMSDIEWLDIQRKLTDAILHFEPRILPQGLQVRC
ISDTKSLDLHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENGHFELKDAG
 
Nucleotide Sequence: 570 bp     [Download]
>gi|512647881|ref|NC_021500.1|:37356-37925 Enterobacter sp. R4-368, complete genome
ATGAGTAACTCTGCGCATGATGAAGAGAGCGACCTGCTGCGTAGCGGCTGGCGCTCGCGGCGCGGGAAAG
AGACCGTTGGCGCGCGCGATAAAATGCAGCCTTCGCTGCTCGATCGCCTGACGGATGACGCGCCGGATAA
AGTGCAGGAGCCGGTGAACAACAATCTGGTTTCGCACTCCGCGCTGCGCCGCCATGTGCTGCGCGATTTG
CAGTGGCTGTTCAACACCATTAATAACGAAGCGCAACAGGATCTCTCAGGTTTTGACCAGGTGCGGCGTT
CGGTGGTGAACTTTGGCGTGTCGCCGCTGGCGGGCAAGCGCATGTCGGATATCGAATGGCTGGATATCCA
GCGCAAACTGACCGACGCGATTTTGCATTTTGAACCGCGCATTCTTCCGCAAGGATTGCAGGTGCGCTGC
ATCTCCGATACTAAGTCGCTGGATCTGCATAACGTCCTGTCGATTGAGATCAAAGGCCGCCTGTGGTGCG
TGCCTTATCCGCTGGAGTTCCTGTTTCGTACCGATGTGGATCTGGAAAACGGGCATTTCGAGCTGAAAGA
CGCGGGGTAA