SecReT6
Protein ID: 512648116
SecReT6 ID809
T6SS typei3
Gene symbol-
Locus tagH650_00845
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]37928..39799 [+]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDR9VFZ6
KEGG IDenr:H650_00845
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-213, Aligned region: 5..623
Protein Sequence: 623 a.a.     [Download]
>gi|512648116|ref|YP_008106025.1| type VI secretion system protein ImpG [Enterobacter sp. R4-368]
MDSKLLEYYNRELAWLREMGQEFAARYPKVAGRLGMRGMDVSDPYVERLMEGFAFLTSRVQLKMDAEFPR
FSQRLLEMVAPNYLAPTPSMAIAELQPDSAKGDLSNGFVVPRGTMMDSQVMKKNGVTCSYTTAHDVTLLP
LKISQVELGGVPADLPLAQVGLSQRGAQSALRIRLSCDGPVNLSHLDFDRLEFFLSGPDMQALKLLELVM
EHQVGILCQANGQKTPPLVLADDALRQEGFSADQALLPDDLRNFDGYRLLQEYFAFPSRFLFISLHGLRT
MLTQSGEAKSFDIIILLDKADAQLERVVDKSHLALHCTPVINLFPKVAERQKLSDSLHEYHLVVDNIRPL
DYEIYAVTKIHASIDGQRDEQTFRPFWSSWSQDEGNYGAYFSLRREQRALSEHAQRYGTRTGYIGSEVFA
SLVDEQHAPWREELRYITAEVLCTSRDLPLMLQQEIGQFVLPDSLPVKTLQLRKGPTPPRPALAEGLSTW
RLISQLQMNYLSLMDGEDGEGAAALRQLLGLYTRLAEAPVARQIEGVRHCVLEPVHRRVPEPGPIVFARG
IGITLTVDEQAFSGFSPYLFGSVLERVFARLVGMNSFTEFTLKSQQRGEVGYWPPRMGKRALI
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|512647881|ref|NC_021500.1|:37928-39799 Enterobacter sp. R4-368, complete genome
ATGGACAGCAAATTACTCGAATATTACAACCGCGAACTGGCCTGGCTGCGCGAAATGGGTCAGGAATTCG
CCGCACGCTACCCGAAAGTTGCCGGGCGTCTGGGTATGCGCGGCATGGACGTCTCCGATCCGTATGTCGA
ACGCCTGATGGAAGGTTTTGCCTTTCTGACCTCGCGCGTGCAGTTAAAAATGGACGCCGAGTTCCCGCGT
TTCTCCCAGCGTTTGCTGGAAATGGTCGCGCCGAATTACCTTGCGCCCACGCCGTCCATGGCGATTGCCG
AACTGCAACCGGACAGCGCGAAAGGCGATTTGAGCAACGGTTTTGTGGTGCCGCGCGGCACCATGATGGA
CAGCCAGGTGATGAAAAAGAACGGCGTCACCTGTAGCTACACCACCGCACATGATGTCACGCTGCTGCCG
CTGAAAATCAGCCAGGTGGAACTGGGCGGTGTGCCCGCCGATCTGCCGCTGGCGCAGGTTGGTTTAAGCC
AGCGCGGGGCGCAAAGCGCACTGCGTATTCGCCTGAGTTGCGACGGCCCGGTAAACCTCAGCCATCTTGA
TTTCGACCGTCTGGAGTTCTTCTTAAGCGGCCCGGATATGCAGGCGCTGAAGCTCCTCGAGCTGGTGATG
GAGCATCAGGTCGGCATTCTGTGCCAGGCGAACGGGCAGAAAACCCCGCCGCTGGTGCTGGCCGACGATG
CGCTGCGCCAGGAAGGGTTCAGCGCAGACCAGGCACTGCTGCCGGACGATTTGCGCAATTTTGACGGCTA
CCGCCTGTTGCAGGAGTACTTTGCTTTTCCGTCGCGTTTCCTGTTTATCAGCCTGCATGGCTTGCGCACG
ATGCTGACGCAAAGTGGCGAAGCGAAGTCCTTCGATATCATCATTCTGCTCGACAAAGCCGATGCGCAGC
TTGAACGGGTGGTGGATAAGAGCCACCTCGCACTTCACTGCACGCCAGTGATTAACCTGTTCCCGAAAGT
GGCGGAACGCCAGAAACTTAGCGACAGCCTGCATGAGTACCATCTGGTGGTCGATAACATCCGTCCGCTG
GATTACGAGATCTACGCCGTTACCAAAATTCACGCCAGCATCGACGGTCAGCGTGATGAACAAACATTTC
GCCCGTTCTGGAGTAGCTGGAGCCAGGACGAAGGTAACTACGGGGCTTACTTTTCGCTGCGCCGTGAACA
GCGTGCGTTATCGGAACATGCGCAGCGTTACGGCACGCGTACCGGCTACATCGGTTCGGAAGTGTTCGCC
TCGCTGGTGGATGAACAGCATGCGCCGTGGCGGGAAGAGTTACGCTACATCACCGCCGAAGTGCTGTGCA
CCAGCCGCGACTTGCCGCTGATGTTGCAGCAGGAGATTGGTCAGTTTGTGTTGCCGGATTCGCTGCCGGT
TAAAACATTACAACTGCGCAAAGGCCCGACACCGCCGCGTCCGGCGCTGGCAGAAGGATTGAGCACCTGG
CGGCTGATCAGCCAGTTGCAGATGAACTATTTAAGCCTGATGGATGGCGAAGACGGTGAAGGCGCTGCGG
CGCTGCGGCAGTTGCTGGGGCTTTATACCCGGCTGGCGGAAGCACCGGTCGCGCGTCAGATCGAAGGCGT
GCGCCACTGCGTGCTTGAACCGGTGCATCGCCGCGTGCCGGAACCGGGACCGATTGTTTTCGCGCGCGGT
ATTGGCATTACCCTGACGGTCGATGAGCAGGCGTTCTCCGGCTTCAGTCCGTACCTGTTTGGCAGCGTGC
TGGAGCGCGTTTTTGCCCGTCTGGTGGGCATGAACAGCTTTACCGAGTTCACGCTTAAGAGCCAGCAGCG
CGGGGAAGTGGGTTACTGGCCGCCGCGCATGGGCAAGAGGGCGCTGATATGA